BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0654 (621 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_01_0019 + 403078-404211 31 0.97 08_01_1002 + 10171942-10172859,10173369-10173452 28 6.9 03_06_0399 - 33632811-33633107,33633236-33633385,33633705-336340... 27 9.1 >09_01_0019 + 403078-404211 Length = 377 Score = 30.7 bits (66), Expect = 0.97 Identities = 17/42 (40%), Positives = 21/42 (50%) Frame = +2 Query: 368 GESGFDSGEGA*ETATTSKEGSRRANYPLPARGGSDQK*RYG 493 G S DSG GA ++A K SRR + GSD R+G Sbjct: 321 GASDGDSGSGASDSADDRKRSSRRRRHRKSESSGSDGDERHG 362 >08_01_1002 + 10171942-10172859,10173369-10173452 Length = 333 Score = 27.9 bits (59), Expect = 6.9 Identities = 24/68 (35%), Positives = 35/68 (51%), Gaps = 5/68 (7%) Frame = +3 Query: 219 RASRPKSLILMN--LDNFCRSHGQVPATHLSNVCLINF--RW*FLRLPWL-SRVTGNQGS 383 RA + SL L +DN CR G++P + +N+ + F FL WL SRV + S Sbjct: 242 RAPKLHSLTLWTPAVDNGCRVAGELPLLNAANISVDAFLGTEDFLDTLWLVSRVKVLKFS 301 Query: 384 IPEREPEK 407 + +RE K Sbjct: 302 VRDRENRK 309 >03_06_0399 - 33632811-33633107,33633236-33633385,33633705-33634029, 33635315-33635982,33636967-33637212,33637405-33637545, 33637807-33637856,33637943-33638060,33638304-33638910, 33639339-33639463,33639813-33639869,33639952-33640023, 33640100-33640232,33640305-33640428,33640522-33640576, 33640672-33641322 Length = 1272 Score = 27.5 bits (58), Expect = 9.1 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = -1 Query: 429 PSLDVVAVSQAPSPESNPDSPLP 361 P LD ++Q PSP +NP P P Sbjct: 55 PPLDEETLAQFPSPPTNPSPPPP 77 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,986,183 Number of Sequences: 37544 Number of extensions: 376510 Number of successful extensions: 979 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 958 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 979 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1502076244 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -