BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0652 (697 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_36408| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) 66 3e-11 SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 8e-11 SB_29084| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_7769| Best HMM Match : Histone (HMM E-Value=0.2) 62 4e-10 SB_36014| Best HMM Match : DUF437 (HMM E-Value=6.4) 62 6e-10 SB_32110| Best HMM Match : PEGSRP (HMM E-Value=9.6) 62 6e-10 SB_43339| Best HMM Match : SAC3_GANP (HMM E-Value=1.8e-09) 62 6e-10 SB_35835| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_7973| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 7e-10 SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) 61 1e-09 SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_13480| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_12187| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) 60 1e-09 SB_52081| Best HMM Match : DUF1634 (HMM E-Value=0.55) 60 1e-09 SB_40229| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_54503| Best HMM Match : DUF753 (HMM E-Value=4.7) 60 2e-09 SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) 60 2e-09 SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_10456| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_2468| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_45900| Best HMM Match : Chordopox_A13L (HMM E-Value=7.4) 60 2e-09 SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_46308| Best HMM Match : IMS (HMM E-Value=0) 60 2e-09 SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_30786| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_27047| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_7849| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_4191| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_59| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_54005| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_50972| Best HMM Match : MH1 (HMM E-Value=7.1) 60 2e-09 SB_50222| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_47031| Best HMM Match : Protamine_P1 (HMM E-Value=7) 60 2e-09 SB_19310| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_11962| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 3e-09 SB_18289| Best HMM Match : IgG_binding_B (HMM E-Value=7) 59 3e-09 SB_15873| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 3e-09 SB_11632| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 3e-09 SB_6117| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 3e-09 SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) 59 3e-09 SB_51949| Best HMM Match : Toxin_14 (HMM E-Value=0.051) 59 3e-09 SB_41244| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 3e-09 SB_36598| Best HMM Match : E-MAP-115 (HMM E-Value=0.092) 59 3e-09 SB_30551| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 3e-09 SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) 59 4e-09 SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) 59 4e-09 SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) 59 4e-09 SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) 59 4e-09 SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_46412| Best HMM Match : HEAT (HMM E-Value=8) 59 4e-09 SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_43569| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2) 59 4e-09 SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_42725| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_41806| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_41728| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_41712| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_39942| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_39373| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_39201| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_38916| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_38016| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_37690| Best HMM Match : IgG_binding_B (HMM E-Value=4.2) 59 4e-09 SB_37661| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_37536| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_37412| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) 59 4e-09 SB_36865| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78) 59 4e-09 SB_35849| Best HMM Match : Fibrinogen_C (HMM E-Value=0.15) 59 4e-09 SB_35689| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) 59 4e-09 SB_34829| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_34793| Best HMM Match : TIL (HMM E-Value=4.5) 59 4e-09 SB_34683| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_34501| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_34403| Best HMM Match : IgG_binding_B (HMM E-Value=9.3) 59 4e-09 SB_34015| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_33403| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_33270| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_32674| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_32508| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_32411| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_31889| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_31658| Best HMM Match : Arm (HMM E-Value=0.91) 59 4e-09 SB_31056| Best HMM Match : Virus_P-coat (HMM E-Value=6.4) 59 4e-09 SB_30810| Best HMM Match : JmjC (HMM E-Value=0.0021) 59 4e-09 SB_30192| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_28922| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_28866| Best HMM Match : PhdYeFM (HMM E-Value=8.3) 59 4e-09 SB_28269| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_27927| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_27779| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_27619| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_25936| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_24859| Best HMM Match : HAP (HMM E-Value=6.4) 59 4e-09 SB_24787| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_24544| Best HMM Match : PSCyt1 (HMM E-Value=4.3) 59 4e-09 SB_24181| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_23437| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_22658| Best HMM Match : Protamine_3 (HMM E-Value=9.6) 59 4e-09 SB_22468| Best HMM Match : CUT (HMM E-Value=6.8) 59 4e-09 SB_22375| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_22254| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_21247| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_20864| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_20839| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_20747| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_19461| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_18812| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_18654| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_18436| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_17565| Best HMM Match : EGF (HMM E-Value=5.1e-05) 59 4e-09 SB_16725| Best HMM Match : DAGAT (HMM E-Value=1e-39) 59 4e-09 SB_16155| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_15493| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_15346| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_15295| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_15150| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_15134| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_15127| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_14936| Best HMM Match : Pep_M12B_propep (HMM E-Value=9.7) 59 4e-09 SB_14862| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_14045| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_13372| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_13236| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_12962| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_12873| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_12726| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_12236| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_12019| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_11249| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_10911| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_10687| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_10031| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_9995| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_9697| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_9450| Best HMM Match : CM_1 (HMM E-Value=3.1) 59 4e-09 SB_8806| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_8714| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_8621| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_8582| Best HMM Match : CsgG (HMM E-Value=4.9e-06) 59 4e-09 SB_8530| Best HMM Match : ThiC (HMM E-Value=2.7e-07) 59 4e-09 SB_8498| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_7142| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_6842| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_6464| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_5521| Best HMM Match : SWIM (HMM E-Value=6.9) 59 4e-09 SB_5457| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_4705| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_4190| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_3728| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_3676| Best HMM Match : Cuticle_2 (HMM E-Value=3.2) 59 4e-09 SB_2230| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_1204| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_965| Best HMM Match : IgG_binding_B (HMM E-Value=8.5) 59 4e-09 SB_58985| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_58797| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_57506| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_56970| Best HMM Match : Thaumatin (HMM E-Value=5.4) 59 4e-09 SB_55779| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_55121| Best HMM Match : DUF971 (HMM E-Value=8.5) 59 4e-09 SB_55030| Best HMM Match : Toxin_27 (HMM E-Value=1.2) 59 4e-09 SB_54995| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_54425| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_53532| Best HMM Match : IgG_binding_B (HMM E-Value=7.8) 59 4e-09 SB_51954| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_51352| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_51253| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_49112| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_48731| Best HMM Match : zf-C3HC4 (HMM E-Value=6.5e-08) 59 4e-09 SB_48358| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_46185| Best HMM Match : Flt3_lig (HMM E-Value=3.3) 59 4e-09 SB_46118| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_45537| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_45065| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_44512| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_44400| Best HMM Match : AT_hook (HMM E-Value=3.3) 59 4e-09 SB_43660| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_42664| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_42518| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_42300| Best HMM Match : Filament_head (HMM E-Value=4.9) 59 4e-09 SB_41564| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_39279| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_36908| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_35614| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_34678| Best HMM Match : Bromodomain (HMM E-Value=9e-25) 59 4e-09 SB_34602| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_34424| Best HMM Match : RNase_U2 (HMM E-Value=7.5) 59 4e-09 SB_32133| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_31592| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_31269| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_31079| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_30664| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_29177| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_28552| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_27244| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_26386| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_25785| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_22440| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_20758| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_20651| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_20620| Best HMM Match : zf-HIT (HMM E-Value=8.5e-10) 59 4e-09 SB_20097| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_19831| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_19077| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_16729| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_15849| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_12231| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_12114| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_12047| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_11928| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_11382| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_11225| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_10984| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_9428| Best HMM Match : Vicilin_N (HMM E-Value=4.2) 59 4e-09 SB_9128| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_8032| Best HMM Match : IBB (HMM E-Value=0.46) 59 4e-09 SB_7742| Best HMM Match : HEAT (HMM E-Value=9e-23) 59 4e-09 SB_7402| Best HMM Match : Extensin_2 (HMM E-Value=2) 59 4e-09 SB_6875| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_5394| Best HMM Match : PEGSRP (HMM E-Value=1.5) 59 4e-09 SB_2918| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_1945| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_1078| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_969| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_56603| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 5e-09 SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) 58 5e-09 SB_30142| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 5e-09 SB_20629| Best HMM Match : WD40 (HMM E-Value=0.0014) 58 5e-09 SB_55650| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 5e-09 SB_43825| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 5e-09 SB_42133| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 5e-09 SB_38521| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 5e-09 SB_37693| Best HMM Match : PHD (HMM E-Value=8.7e-35) 58 5e-09 SB_36830| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 5e-09 SB_36374| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 5e-09 SB_23894| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 5e-09 SB_21520| Best HMM Match : Trypsin (HMM E-Value=0) 58 5e-09 SB_10099| Best HMM Match : Neur_chan_LBD (HMM E-Value=3.6e-17) 58 5e-09 SB_1283| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 5e-09 SB_59802| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_59119| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_58967| Best HMM Match : Sec23_BS (HMM E-Value=5.9) 58 7e-09 SB_58852| Best HMM Match : Hormone_4 (HMM E-Value=2.8) 58 7e-09 SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_58713| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_58195| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_58029| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_56369| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_55830| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) 58 7e-09 SB_54985| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_53675| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_53669| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_53077| Best HMM Match : SRP54_N (HMM E-Value=1.8) 58 7e-09 SB_52837| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_51967| Best HMM Match : Wzy_C (HMM E-Value=7.3) 58 7e-09 SB_51749| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_51748| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_50928| Best HMM Match : 7tm_2 (HMM E-Value=4.7e-07) 58 7e-09 SB_50489| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_50209| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_50159| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_50054| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_49806| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_48895| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_48422| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_47991| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_47859| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_47433| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) 58 7e-09 SB_46080| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_45570| Best HMM Match : Euplotes_phero (HMM E-Value=2.6) 58 7e-09 SB_45449| Best HMM Match : Glyco_hydro_47 (HMM E-Value=1.4e-07) 58 7e-09 SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) 58 7e-09 SB_43819| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) 58 7e-09 SB_42373| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_42112| Best HMM Match : Herpes_UL49_2 (HMM E-Value=1.5) 58 7e-09 SB_41202| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_41136| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_41068| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_40980| Best HMM Match : ANF_receptor (HMM E-Value=0.00014) 58 7e-09 SB_40764| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_40601| Best HMM Match : VWA_CoxE (HMM E-Value=6.3) 58 7e-09 SB_40576| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_40463| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_40182| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_40068| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 58 7e-09 SB_40003| Best HMM Match : YTV (HMM E-Value=8.9) 58 7e-09 SB_39444| Best HMM Match : SAC3_GANP (HMM E-Value=0.68) 58 7e-09 SB_38813| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_38774| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_38425| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_38203| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_37771| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_36681| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_36207| Best HMM Match : 7kD_coat (HMM E-Value=7.6) 58 7e-09 SB_35317| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_35151| Best HMM Match : DUF589 (HMM E-Value=7.5) 58 7e-09 SB_34685| Best HMM Match : RNA_pol_A_bac (HMM E-Value=1.8) 58 7e-09 SB_34478| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_29043| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_28650| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_28487| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_28424| Best HMM Match : SAM_1 (HMM E-Value=8e-06) 58 7e-09 SB_28245| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_27897| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_27137| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_27095| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_27010| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_26954| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_26672| Best HMM Match : Exo_endo_phos (HMM E-Value=0.46) 58 7e-09 SB_26607| Best HMM Match : K_tetra (HMM E-Value=3.3e-08) 58 7e-09 SB_25727| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_25469| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_25193| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_24322| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_23294| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_23196| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_23195| Best HMM Match : zf-C3HC4 (HMM E-Value=1.3e-10) 58 7e-09 SB_22108| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_21853| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_21523| Best HMM Match : Pkinase (HMM E-Value=9.5e-14) 58 7e-09 SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_20847| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_18983| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_18796| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_18538| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_18411| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_18318| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_18158| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_17237| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_15818| Best HMM Match : Apo-VLDL-II (HMM E-Value=1.2) 58 7e-09 SB_15447| Best HMM Match : C1_1 (HMM E-Value=0.11) 58 7e-09 SB_15375| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_14672| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_14518| Best HMM Match : MIB_HERC2 (HMM E-Value=2.4e-38) 58 7e-09 SB_14175| Best HMM Match : GBP_repeat (HMM E-Value=3.8) 58 7e-09 SB_14044| Best HMM Match : EGF_CA (HMM E-Value=4.1e-13) 58 7e-09 SB_13919| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_13475| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_13295| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_13049| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_12559| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_12016| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_11991| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_11294| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_10976| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_10247| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_9391| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_9055| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_8565| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_8424| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_8222| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_8126| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_7261| Best HMM Match : RHS (HMM E-Value=5.3) 58 7e-09 SB_7005| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_6796| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_6339| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_6047| Best HMM Match : CXC (HMM E-Value=7.7) 58 7e-09 SB_5753| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_5503| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_5427| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_4286| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_4268| Best HMM Match : MtrG (HMM E-Value=1.2) 58 7e-09 SB_4192| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_3720| Best HMM Match : RVT_1 (HMM E-Value=0.0031) 58 7e-09 SB_3671| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_2384| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_1609| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_751| Best HMM Match : rve (HMM E-Value=7.5e-12) 58 7e-09 SB_266| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_58440| Best HMM Match : Ribosomal_L9_C (HMM E-Value=0.81) 58 7e-09 SB_58394| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_57021| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_56955| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_56767| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_56729| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_56672| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_56555| Best HMM Match : 7tm_1 (HMM E-Value=4.4) 58 7e-09 SB_56358| Best HMM Match : Fork_head (HMM E-Value=1.2e-30) 58 7e-09 SB_56099| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7) 58 7e-09 SB_55954| Best HMM Match : TIL (HMM E-Value=0.74) 58 7e-09 SB_55182| Best HMM Match : T4_deiodinase (HMM E-Value=0) 58 7e-09 SB_55138| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_55112| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_54421| Best HMM Match : HipA_C (HMM E-Value=7.5) 58 7e-09 SB_54343| Best HMM Match : TipAS (HMM E-Value=0.77) 58 7e-09 SB_54153| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_53974| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_53662| Best HMM Match : Protamine_P2 (HMM E-Value=9.2) 58 7e-09 SB_53598| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_53044| Best HMM Match : TcpA (HMM E-Value=3.1) 58 7e-09 SB_52956| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_51739| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_51732| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_51296| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_51109| Best HMM Match : ATP-cone (HMM E-Value=0.76) 58 7e-09 SB_50818| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_50491| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_50286| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_50081| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_50019| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_49981| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_49899| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_49895| Best HMM Match : NACHT (HMM E-Value=7.7) 58 7e-09 SB_49629| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_48632| Best HMM Match : DUF265 (HMM E-Value=7.6e-22) 58 7e-09 SB_47940| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_47474| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_47304| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_47265| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37) 58 7e-09 SB_46484| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_45749| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_45575| Best HMM Match : Keratin_B2 (HMM E-Value=8.8) 58 7e-09 SB_45266| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_44239| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_44171| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_44073| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_43752| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_43722| Best HMM Match : TPR_4 (HMM E-Value=0.69) 58 7e-09 SB_42847| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_42555| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_41545| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_41358| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_41085| Best HMM Match : Auxin_repressed (HMM E-Value=9) 58 7e-09 SB_40884| Best HMM Match : Homeobox (HMM E-Value=0.068) 58 7e-09 SB_40300| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_40139| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_39391| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_39208| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_38658| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_38558| Best HMM Match : TFIIA_gamma_N (HMM E-Value=7.4) 58 7e-09 SB_38282| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_38080| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_37703| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_37072| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_36723| Best HMM Match : DUF753 (HMM E-Value=9.9) 58 7e-09 SB_36604| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_35131| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_34873| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_34844| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 >SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 71.7 bits (168), Expect = 5e-13 Identities = 31/38 (81%), Positives = 32/38 (84%) Frame = +2 Query: 584 IRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 IRPIVSRITIHW +RRDWENPGV QLNRLAAH PF Sbjct: 18 IRPIVSRITIHWPSFYKRRDWENPGVNQLNRLAAHPPF 55 >SB_36408| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 458 Score = 70.5 bits (165), Expect = 1e-12 Identities = 34/46 (73%), Positives = 36/46 (78%) Frame = +2 Query: 560 PRGGARYPIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 PR A Y + +SRITIHW VLQRRDWENPGVTQLNRLAAH PF Sbjct: 267 PRSMADYWMA--LSRITIHWPSVLQRRDWENPGVTQLNRLAAHPPF 310 >SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) Length = 768 Score = 66.1 bits (154), Expect = 3e-11 Identities = 28/37 (75%), Positives = 29/37 (78%) Frame = -1 Query: 691 GMCCKAIKLGNARVFPVTTL*NDGPVNCNTTHYRANW 581 GMCCKAIKLGNA VFP + PVNCNTTHYRANW Sbjct: 17 GMCCKAIKLGNASVFPSHDVVKRRPVNCNTTHYRANW 53 >SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 66.1 bits (154), Expect = 3e-11 Identities = 28/37 (75%), Positives = 29/37 (78%) Frame = -1 Query: 691 GMCCKAIKLGNARVFPVTTL*NDGPVNCNTTHYRANW 581 GMCCKAIKLGNA VFP + PVNCNTTHYRANW Sbjct: 31 GMCCKAIKLGNASVFPSHDVVKRRPVNCNTTHYRANW 67 >SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 64.5 bits (150), Expect = 8e-11 Identities = 27/37 (72%), Positives = 29/37 (78%) Frame = -1 Query: 691 GMCCKAIKLGNARVFPVTTL*NDGPVNCNTTHYRANW 581 GMCCKAIKLGNA+ FP + PVNCNTTHYRANW Sbjct: 23 GMCCKAIKLGNAKGFPSHDVVKRRPVNCNTTHYRANW 59 Score = 32.7 bits (71), Expect = 0.29 Identities = 15/26 (57%), Positives = 18/26 (69%) Frame = -3 Query: 695 RGNVLQGD*VG*RQGFPSHDVVKRRP 618 RG + +G +GFPSHDVVKRRP Sbjct: 22 RGMCCKAIKLGNAKGFPSHDVVKRRP 47 >SB_29084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 116 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/45 (64%), Positives = 32/45 (71%) Frame = +2 Query: 563 RGGARYPIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 RGG P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 43 RGGIGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 87 >SB_7769| Best HMM Match : Histone (HMM E-Value=0.2) Length = 150 Score = 62.1 bits (144), Expect = 4e-10 Identities = 28/45 (62%), Positives = 32/45 (71%) Frame = +2 Query: 563 RGGARYPIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 +GG P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 51 QGGVGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 95 >SB_36014| Best HMM Match : DUF437 (HMM E-Value=6.4) Length = 240 Score = 61.7 bits (143), Expect = 6e-10 Identities = 32/59 (54%), Positives = 34/59 (57%) Frame = -2 Query: 696 KGECAARRLSWVTPGFSQSRRCKTTAQ*IVIRLTIGRIGYRAPPRGXXXXLAWHISWIQ 520 KG CAARRLSWVTPGFSQSRRCKTTA + L + G P R H W Q Sbjct: 44 KGGCAARRLSWVTPGFSQSRRCKTTASAKLACLQVDSRGSPCPQRLAPPPKQGHPPWDQ 102 >SB_32110| Best HMM Match : PEGSRP (HMM E-Value=9.6) Length = 160 Score = 61.7 bits (143), Expect = 6e-10 Identities = 30/52 (57%), Positives = 35/52 (67%) Frame = +2 Query: 542 AKSYKSPRGGARYPIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 ++ Y SP G P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 57 SRLYSSPPGD---PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 105 >SB_43339| Best HMM Match : SAC3_GANP (HMM E-Value=1.8e-09) Length = 657 Score = 61.7 bits (143), Expect = 6e-10 Identities = 29/48 (60%), Positives = 33/48 (68%) Frame = +2 Query: 554 KSPRGGARYPIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 +S G +YP ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 13 RSYLGYIKYPPESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 60 >SB_35835| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 61.7 bits (143), Expect = 6e-10 Identities = 28/50 (56%), Positives = 34/50 (68%) Frame = +2 Query: 548 SYKSPRGGARYPIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 +Y++ R P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 16 TYQTTRSTVGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 65 >SB_7973| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 61.3 bits (142), Expect = 7e-10 Identities = 29/48 (60%), Positives = 33/48 (68%) Frame = +2 Query: 554 KSPRGGARYPIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 K+P A P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 5 KTPPTPAGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 52 >SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 60.9 bits (141), Expect = 1e-09 Identities = 30/50 (60%), Positives = 34/50 (68%) Frame = +2 Query: 548 SYKSPRGGARYPIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 +Y SP G P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 5 TYMSPFGD---PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 51 >SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 917 Score = 60.9 bits (141), Expect = 1e-09 Identities = 30/49 (61%), Positives = 33/49 (67%) Frame = +2 Query: 551 YKSPRGGARYPIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 YK RG P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 814 YKPSRGD---PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 859 >SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 60.5 bits (140), Expect = 1e-09 Identities = 30/53 (56%), Positives = 34/53 (64%) Frame = +2 Query: 539 HAKSYKSPRGGARYPIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 H + S RG P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 73 HNSLHNSTRGD---PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 122 >SB_13480| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 60.5 bits (140), Expect = 1e-09 Identities = 28/44 (63%), Positives = 31/44 (70%) Frame = +2 Query: 566 GGARYPIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 G A P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 38 GDAGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 81 >SB_12187| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 60.5 bits (140), Expect = 1e-09 Identities = 30/53 (56%), Positives = 35/53 (66%), Gaps = 2/53 (3%) Frame = +2 Query: 545 KSYKSPR--GGARYPIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 + Y +PR G P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 68 QGYPNPRINGEDGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 120 >SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) Length = 117 Score = 60.5 bits (140), Expect = 1e-09 Identities = 25/37 (67%), Positives = 28/37 (75%) Frame = -1 Query: 691 GMCCKAIKLGNARVFPVTTL*NDGPVNCNTTHYRANW 581 GMCCK+IKL +A VFP + PVNCNTTHYRANW Sbjct: 25 GMCCKSIKLAHASVFPSHDVVKRRPVNCNTTHYRANW 61 >SB_52081| Best HMM Match : DUF1634 (HMM E-Value=0.55) Length = 189 Score = 60.5 bits (140), Expect = 1e-09 Identities = 31/63 (49%), Positives = 38/63 (60%) Frame = +2 Query: 509 ILVHWIQLICHAKSYKSPRGGARYPIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAH 688 +LV + +I K + A P+ ++ AVVLQRRDWENPGVTQLNRLAAH Sbjct: 72 LLVSILFMIIFYKKFGLIATSAGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAH 131 Query: 689 SPF 697 PF Sbjct: 132 PPF 134 >SB_40229| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 60.5 bits (140), Expect = 1e-09 Identities = 28/51 (54%), Positives = 32/51 (62%) Frame = +2 Query: 545 KSYKSPRGGARYPIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 K + R P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 39 KKFNQARVNGGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 89 >SB_54503| Best HMM Match : DUF753 (HMM E-Value=4.7) Length = 141 Score = 60.1 bits (139), Expect = 2e-09 Identities = 29/44 (65%), Positives = 31/44 (70%) Frame = -2 Query: 696 KGECAARRLSWVTPGFSQSRRCKTTAQ*IVIRLTIGRIGYRAPP 565 KG CAARRLSWVTPGFSQSRRCKTTA + L + G PP Sbjct: 44 KGGCAARRLSWVTPGFSQSRRCKTTASAKLACLQVDSRGSPFPP 87 >SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) Length = 181 Score = 60.1 bits (139), Expect = 2e-09 Identities = 30/47 (63%), Positives = 33/47 (70%) Frame = +2 Query: 557 SPRGGARYPIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 S RGG P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 82 SIRGGD--PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 126 >SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 60.1 bits (139), Expect = 2e-09 Identities = 34/80 (42%), Positives = 45/80 (56%), Gaps = 6/80 (7%) Frame = +2 Query: 476 DEEDAGVYDPHILVHWIQLICHAKSYKSPRGGARY------PIRPIVSRITIHWAVVLQR 637 D D GVY ++L + + ++ + +G A P+ ++ AVVLQR Sbjct: 8 DGTDDGVYRKNVLPFELHVTIVHQNTNNVQGIAHMALTVGDPLESTCRHASLALAVVLQR 67 Query: 638 RDWENPGVTQLNRLAAHSPF 697 RDWENPGVTQLNRLAAH PF Sbjct: 68 RDWENPGVTQLNRLAAHPPF 87 >SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1580 Score = 60.1 bits (139), Expect = 2e-09 Identities = 29/46 (63%), Positives = 32/46 (69%) Frame = +2 Query: 560 PRGGARYPIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P GG P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 1046 PSGGD--PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 1089 >SB_10456| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 60.1 bits (139), Expect = 2e-09 Identities = 30/52 (57%), Positives = 35/52 (67%) Frame = +2 Query: 542 AKSYKSPRGGARYPIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 ++S PR G P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 10 SRSSFDPRKGD--PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 59 >SB_2468| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 60.1 bits (139), Expect = 2e-09 Identities = 28/51 (54%), Positives = 33/51 (64%) Frame = +2 Query: 545 KSYKSPRGGARYPIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 ++Y R P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 47 RTYSIFEAQKRDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 97 >SB_45900| Best HMM Match : Chordopox_A13L (HMM E-Value=7.4) Length = 152 Score = 60.1 bits (139), Expect = 2e-09 Identities = 31/47 (65%), Positives = 33/47 (70%), Gaps = 4/47 (8%) Frame = +2 Query: 569 GARYPIRPIVSRITIHW----AVVLQRRDWENPGVTQLNRLAAHSPF 697 G YP P SR + + AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 42 GLNYPFVPKSSRHSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF 88 >SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 59.7 bits (138), Expect = 2e-09 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +2 Query: 563 RGGARYPIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 RG P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 1 RGEYGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 45 >SB_46308| Best HMM Match : IMS (HMM E-Value=0) Length = 1245 Score = 59.7 bits (138), Expect = 2e-09 Identities = 29/51 (56%), Positives = 33/51 (64%) Frame = +2 Query: 545 KSYKSPRGGARYPIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 K+ K G P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 1166 KAGKRRSQGKGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 1216 >SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 189 Score = 59.7 bits (138), Expect = 2e-09 Identities = 27/41 (65%), Positives = 30/41 (73%) Frame = +2 Query: 575 RYPIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 R P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 94 RDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 134 >SB_30786| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 59.7 bits (138), Expect = 2e-09 Identities = 29/46 (63%), Positives = 32/46 (69%) Frame = +2 Query: 560 PRGGARYPIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 PR G P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 3 PRDGD--PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 46 >SB_27047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/67 (50%), Positives = 38/67 (56%), Gaps = 1/67 (1%) Frame = +2 Query: 500 DPHILV-HWIQLICHAKSYKSPRGGARYPIRPIVSRITIHWAVVLQRRDWENPGVTQLNR 676 DPH L H H K+ G P+ ++ AVVLQRRDWENPGVTQLNR Sbjct: 37 DPHSLTTHTNSGSSHQKAKDLKIGD---PLESTCRHASLALAVVLQRRDWENPGVTQLNR 93 Query: 677 LAAHSPF 697 LAAH PF Sbjct: 94 LAAHPPF 100 >SB_7849| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 59.7 bits (138), Expect = 2e-09 Identities = 28/34 (82%), Positives = 29/34 (85%) Frame = +2 Query: 596 VSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 +SRIT AVVLQRRDWEN GVTQLNRLAAH PF Sbjct: 88 LSRITNSLAVVLQRRDWENTGVTQLNRLAAHPPF 121 >SB_4191| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 59.7 bits (138), Expect = 2e-09 Identities = 30/54 (55%), Positives = 34/54 (62%) Frame = +2 Query: 536 CHAKSYKSPRGGARYPIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 C K + P A P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 63 CDNKGRRFPNK-AGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 115 >SB_59| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 59.7 bits (138), Expect = 2e-09 Identities = 29/46 (63%), Positives = 33/46 (71%) Frame = -2 Query: 696 KGECAARRLSWVTPGFSQSRRCKTTAQ*IVIRLTIGRIGYRAPPRG 559 KG CAARRLSWVTPGFSQSRRCKTTA +L ++ R P+G Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS---AKLACLQVDSRGSPQG 64 >SB_54005| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 59.7 bits (138), Expect = 2e-09 Identities = 31/54 (57%), Positives = 34/54 (62%) Frame = -2 Query: 696 KGECAARRLSWVTPGFSQSRRCKTTAQ*IVIRLTIGRIGYRAPPRGXXXXLAWH 535 KG CAARRLSWVTPGFSQSRRCKTTA + L + G +P L WH Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTASAKLACLQVDSRG--SPSSARNERLTWH 73 >SB_50972| Best HMM Match : MH1 (HMM E-Value=7.1) Length = 283 Score = 59.7 bits (138), Expect = 2e-09 Identities = 29/45 (64%), Positives = 31/45 (68%) Frame = -2 Query: 696 KGECAARRLSWVTPGFSQSRRCKTTAQ*IVIRLTIGRIGYRAPPR 562 KG CAARRLSWVTPGFSQSRRCKTTA + L + G P R Sbjct: 120 KGGCAARRLSWVTPGFSQSRRCKTTASAKLACLQVDSRGSPGPKR 164 >SB_50222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 59.7 bits (138), Expect = 2e-09 Identities = 30/58 (51%), Positives = 33/58 (56%) Frame = -2 Query: 696 KGECAARRLSWVTPGFSQSRRCKTTAQ*IVIRLTIGRIGYRAPPRGXXXXLAWHISWI 523 KG CAARRLSWVTPGFSQSRRCKTTA + L + G P H W+ Sbjct: 44 KGGCAARRLSWVTPGFSQSRRCKTTASAKLACLQVDSRGSPVVPAAGTKVAYDHEDWL 101 >SB_47031| Best HMM Match : Protamine_P1 (HMM E-Value=7) Length = 128 Score = 59.7 bits (138), Expect = 2e-09 Identities = 29/46 (63%), Positives = 33/46 (71%) Frame = -2 Query: 696 KGECAARRLSWVTPGFSQSRRCKTTAQ*IVIRLTIGRIGYRAPPRG 559 KG CAARRLSWVTPGFSQSRRCKTTA +L ++ R P+G Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS---AKLACLQVDSRGSPQG 64 >SB_19310| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 59.7 bits (138), Expect = 2e-09 Identities = 27/41 (65%), Positives = 30/41 (73%) Frame = +2 Query: 575 RYPIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 R P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 7 RDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 47 >SB_11962| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 79 Score = 59.7 bits (138), Expect = 2e-09 Identities = 27/41 (65%), Positives = 30/41 (73%) Frame = +2 Query: 575 RYPIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 R P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 10 RDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 50 >SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 59.3 bits (137), Expect = 3e-09 Identities = 28/46 (60%), Positives = 31/46 (67%) Frame = +2 Query: 560 PRGGARYPIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 PR P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 41 PRRRDGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 86 >SB_18289| Best HMM Match : IgG_binding_B (HMM E-Value=7) Length = 143 Score = 59.3 bits (137), Expect = 3e-09 Identities = 28/50 (56%), Positives = 32/50 (64%) Frame = +2 Query: 548 SYKSPRGGARYPIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 +YK P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 39 TYKLSIADCGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 88 >SB_15873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 185 Score = 59.3 bits (137), Expect = 3e-09 Identities = 27/43 (62%), Positives = 30/43 (69%) Frame = +2 Query: 569 GARYPIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 G P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 88 GVGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 130 >SB_11632| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 248 Score = 59.3 bits (137), Expect = 3e-09 Identities = 29/63 (46%), Positives = 38/63 (60%) Frame = +2 Query: 509 ILVHWIQLICHAKSYKSPRGGARYPIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAH 688 + + L+ H +++ G P+ ++ AVVLQRRDWENPGVTQLNRLAAH Sbjct: 134 LFADYCALMAHQENHLQTIGD---PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAH 190 Query: 689 SPF 697 PF Sbjct: 191 PPF 193 >SB_6117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 211 Score = 59.3 bits (137), Expect = 3e-09 Identities = 29/55 (52%), Positives = 39/55 (70%), Gaps = 3/55 (5%) Frame = +2 Query: 542 AKSYKSPRGGARY---PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 ++++++P+ RY P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 129 SRAHRTPQEN-RYEGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 182 >SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 237 Score = 59.3 bits (137), Expect = 3e-09 Identities = 27/36 (75%), Positives = 27/36 (75%) Frame = -1 Query: 691 GMCCKAIKLGNARVFPVTTL*NDGPVNCNTTHYRAN 584 GMCCKAIKLGNAR FP PVNCNTTHYRAN Sbjct: 62 GMCCKAIKLGNARGFPSHDGEKRRPVNCNTTHYRAN 97 >SB_51949| Best HMM Match : Toxin_14 (HMM E-Value=0.051) Length = 387 Score = 59.3 bits (137), Expect = 3e-09 Identities = 29/54 (53%), Positives = 34/54 (62%) Frame = +2 Query: 536 CHAKSYKSPRGGARYPIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 CH + + G P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 281 CHYNPRNTSQVGD--PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 332 >SB_41244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 268 Score = 59.3 bits (137), Expect = 3e-09 Identities = 28/48 (58%), Positives = 34/48 (70%) Frame = +2 Query: 554 KSPRGGARYPIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 ++P+G P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 186 ENPKGD---PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 230 >SB_36598| Best HMM Match : E-MAP-115 (HMM E-Value=0.092) Length = 783 Score = 59.3 bits (137), Expect = 3e-09 Identities = 27/43 (62%), Positives = 30/43 (69%) Frame = +2 Query: 569 GARYPIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 G P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 703 GVGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 745 >SB_30551| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 59.3 bits (137), Expect = 3e-09 Identities = 27/39 (69%), Positives = 32/39 (82%), Gaps = 3/39 (7%) Frame = +2 Query: 590 PIVSRITIHW---AVVLQRRDWENPGVTQLNRLAAHSPF 697 P++ R+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 50 PVMGRLESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF 88 >SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 50 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 88 >SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 37 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 75 >SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 16 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 54 >SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 4 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 42 >SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 17 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 55 >SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 6 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 44 >SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 4 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 42 >SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 4 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 42 >SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) Length = 195 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 102 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 140 >SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 27 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 65 >SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 8 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 46 >SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 25 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 63 >SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 76 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 114 >SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 25 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 63 >SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 120 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 158 >SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 10 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 48 >SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) Length = 234 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 141 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 179 >SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 45 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 83 >SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 9 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 47 >SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 4 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 42 >SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 21 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 59 >SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 36 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 74 >SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 28 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 66 >SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 63 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 101 >SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 10 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 48 >SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 45 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 83 >SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) Length = 318 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 88 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 126 >SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) Length = 154 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 61 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 99 >SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 16 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 54 >SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 562 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 134 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 172 >SB_46412| Best HMM Match : HEAT (HMM E-Value=8) Length = 140 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 47 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 85 >SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 76 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 114 >SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 20 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 58 >SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 113 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 151 >SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 65 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 103 >SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 19 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 57 >SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 4 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 42 >SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 89 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 22 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 60 >SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 24 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 62 >SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 72 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 110 >SB_43569| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 28 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 66 >SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2) Length = 165 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 72 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 110 >SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 72 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 110 >SB_42725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 9 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 47 >SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 53 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 91 >SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 12 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 50 >SB_41806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 4 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 42 >SB_41728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 94 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 12 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 50 >SB_41712| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 198 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 31 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 69 >SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 64 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 102 >SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 55 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 93 >SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 172 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 79 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 117 >SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 29 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 67 >SB_39942| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 79 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 117 >SB_39373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 5 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 43 >SB_39201| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 8 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 46 >SB_38916| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 19 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 57 >SB_38016| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 215 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 122 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 160 >SB_37690| Best HMM Match : IgG_binding_B (HMM E-Value=4.2) Length = 263 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 170 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 208 >SB_37661| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 397 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 158 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 196 >SB_37536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 47 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 85 >SB_37412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 7 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 45 >SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) Length = 227 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 134 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 172 >SB_36865| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 46 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 84 >SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78) Length = 197 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 104 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 142 >SB_35849| Best HMM Match : Fibrinogen_C (HMM E-Value=0.15) Length = 631 Score = 58.8 bits (136), Expect = 4e-09 Identities = 27/36 (75%), Positives = 29/36 (80%) Frame = -2 Query: 696 KGECAARRLSWVTPGFSQSRRCKTTAQ*IVIRLTIG 589 KG CAARRLSWVTPGFSQSRRCKTTA + L +G Sbjct: 471 KGGCAARRLSWVTPGFSQSRRCKTTASAKLACLQVG 506 >SB_35689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 11 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 49 >SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) Length = 1060 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 640 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 678 >SB_34829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 27 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 65 >SB_34793| Best HMM Match : TIL (HMM E-Value=4.5) Length = 242 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 149 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 187 >SB_34683| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 102 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 35 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 73 >SB_34501| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 87 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 20 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 58 >SB_34403| Best HMM Match : IgG_binding_B (HMM E-Value=9.3) Length = 135 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 93 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 131 >SB_34015| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 10 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 48 >SB_33403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 46 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 84 >SB_33270| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 58 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 96 >SB_32674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 5 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 43 >SB_32508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 115 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 48 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 86 >SB_32411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 59 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 97 >SB_31889| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 58.8 bits (136), Expect = 4e-09 Identities = 29/45 (64%), Positives = 32/45 (71%) Frame = -2 Query: 696 KGECAARRLSWVTPGFSQSRRCKTTAQ*IVIRLTIGRIGYRAPPR 562 KG CAARRLSWVTPGFSQSRRCKTTA +L ++ R PR Sbjct: 44 KGGCAARRLSWVTPGFSQSRRCKTTAS---AKLACLQVDSRGSPR 85 >SB_31658| Best HMM Match : Arm (HMM E-Value=0.91) Length = 249 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 173 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 211 >SB_31056| Best HMM Match : Virus_P-coat (HMM E-Value=6.4) Length = 154 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 61 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 99 >SB_30810| Best HMM Match : JmjC (HMM E-Value=0.0021) Length = 546 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 254 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 292 >SB_30192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 22 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 60 >SB_28922| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 58 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 96 >SB_28866| Best HMM Match : PhdYeFM (HMM E-Value=8.3) Length = 185 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 92 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 130 >SB_28269| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 51 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 89 >SB_27927| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 61 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 99 >SB_27779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 61 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 99 >SB_27619| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 5 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 43 >SB_25936| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 71 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 109 >SB_24859| Best HMM Match : HAP (HMM E-Value=6.4) Length = 257 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 164 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 202 >SB_24787| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 112 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 19 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 57 >SB_24544| Best HMM Match : PSCyt1 (HMM E-Value=4.3) Length = 164 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 71 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 109 >SB_24181| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 8 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 46 >SB_23437| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 37 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 75 >SB_22658| Best HMM Match : Protamine_3 (HMM E-Value=9.6) Length = 128 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 61 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 99 >SB_22468| Best HMM Match : CUT (HMM E-Value=6.8) Length = 197 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 130 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 168 >SB_22375| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 16 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 54 >SB_22254| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 56 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 94 >SB_21247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 45 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 83 >SB_20864| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 57 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 95 >SB_20839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 8 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 46 >SB_20747| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 4 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 42 >SB_19461| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 26 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 64 >SB_18812| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 32 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 70 >SB_18654| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 392 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 289 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 327 >SB_18436| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 94 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 27 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 65 >SB_17565| Best HMM Match : EGF (HMM E-Value=5.1e-05) Length = 162 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 69 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 107 >SB_16725| Best HMM Match : DAGAT (HMM E-Value=1e-39) Length = 571 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 179 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 217 >SB_16155| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 75 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 113 >SB_15493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 26 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 64 >SB_15346| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 38 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 76 >SB_15295| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 37 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 75 >SB_15150| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 96 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 29 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 67 >SB_15134| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 10 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 48 >SB_15127| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 8 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 46 >SB_14936| Best HMM Match : Pep_M12B_propep (HMM E-Value=9.7) Length = 207 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 114 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 152 >SB_14862| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 31 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 69 >SB_14045| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 57 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 95 >SB_13372| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 6 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 44 >SB_13236| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 42 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 80 >SB_12962| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 76 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 114 >SB_12873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 43 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 81 >SB_12726| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 46 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 84 >SB_12236| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 8 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 46 >SB_12019| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 53 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 91 >SB_11249| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 50 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 88 >SB_10911| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 30 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 68 >SB_10687| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 5 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 43 >SB_10031| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 67 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 105 >SB_9995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 45 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 83 >SB_9697| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 89 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 22 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 60 >SB_9450| Best HMM Match : CM_1 (HMM E-Value=3.1) Length = 186 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 93 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 131 >SB_8806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 34 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 72 >SB_8714| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 24 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 62 >SB_8621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 200 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 107 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 145 >SB_8582| Best HMM Match : CsgG (HMM E-Value=4.9e-06) Length = 233 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 140 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 178 >SB_8530| Best HMM Match : ThiC (HMM E-Value=2.7e-07) Length = 183 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 90 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 128 >SB_8498| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 115 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 22 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 60 >SB_7142| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 43 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 81 >SB_6842| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 25 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 63 >SB_6464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 44 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 82 >SB_5521| Best HMM Match : SWIM (HMM E-Value=6.9) Length = 150 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 57 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 95 >SB_5457| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 207 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 114 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 152 >SB_4705| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 46 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 84 >SB_4190| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 7 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 45 >SB_3728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 6 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 44 >SB_3676| Best HMM Match : Cuticle_2 (HMM E-Value=3.2) Length = 322 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 14 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 52 >SB_2230| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 73 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 111 >SB_1204| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 32 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 70 >SB_965| Best HMM Match : IgG_binding_B (HMM E-Value=8.5) Length = 174 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 81 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 119 >SB_58985| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 229 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 127 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 165 >SB_58797| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 200 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 133 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 171 >SB_57506| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 58.8 bits (136), Expect = 4e-09 Identities = 29/46 (63%), Positives = 32/46 (69%) Frame = -2 Query: 696 KGECAARRLSWVTPGFSQSRRCKTTAQ*IVIRLTIGRIGYRAPPRG 559 KG CAARRLSWVTPGFSQSRRCKTTA +L ++ R P G Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS---AKLACLQVDSRGSPSG 64 >SB_56970| Best HMM Match : Thaumatin (HMM E-Value=5.4) Length = 200 Score = 58.8 bits (136), Expect = 4e-09 Identities = 29/45 (64%), Positives = 32/45 (71%) Frame = -2 Query: 696 KGECAARRLSWVTPGFSQSRRCKTTAQ*IVIRLTIGRIGYRAPPR 562 KG CAARRLSWVTPGFSQSRRCKTTA +L ++ R PR Sbjct: 44 KGGCAARRLSWVTPGFSQSRRCKTTAS---AKLACLQVDSRGSPR 85 >SB_55779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 60 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 98 >SB_55121| Best HMM Match : DUF971 (HMM E-Value=8.5) Length = 174 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 81 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 119 >SB_55030| Best HMM Match : Toxin_27 (HMM E-Value=1.2) Length = 110 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 43 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 81 >SB_54995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 95 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 133 >SB_54425| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 4 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 42 >SB_53532| Best HMM Match : IgG_binding_B (HMM E-Value=7.8) Length = 162 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 69 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 107 >SB_51954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 4 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 42 >SB_51352| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 51 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 89 >SB_51253| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 85 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 18 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 56 >SB_49112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 40 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 78 >SB_48731| Best HMM Match : zf-C3HC4 (HMM E-Value=6.5e-08) Length = 688 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 3 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 41 >SB_48358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 96 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 14 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 52 >SB_46185| Best HMM Match : Flt3_lig (HMM E-Value=3.3) Length = 292 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 41 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 79 >SB_46118| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 60 Score = 58.8 bits (136), Expect = 4e-09 Identities = 29/44 (65%), Positives = 31/44 (70%) Frame = -2 Query: 696 KGECAARRLSWVTPGFSQSRRCKTTAQ*IVIRLTIGRIGYRAPP 565 KG CAARRLSWVTPGFSQSRRCKTTA + L + G A P Sbjct: 15 KGGCAARRLSWVTPGFSQSRRCKTTASAKLACLQVDSRGSPAVP 58 >SB_45537| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 4 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 42 >SB_45065| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 44 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 82 >SB_44512| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 215 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 13 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 51 >SB_44400| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 328 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 235 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 273 >SB_43660| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 69 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 107 >SB_42664| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 36 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 74 >SB_42518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 4 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 42 >SB_42300| Best HMM Match : Filament_head (HMM E-Value=4.9) Length = 152 Score = 58.8 bits (136), Expect = 4e-09 Identities = 29/45 (64%), Positives = 32/45 (71%) Frame = -2 Query: 696 KGECAARRLSWVTPGFSQSRRCKTTAQ*IVIRLTIGRIGYRAPPR 562 KG CAARRLSWVTPGFSQSRRCKTTA +L ++ R PR Sbjct: 44 KGGCAARRLSWVTPGFSQSRRCKTTAS---AKLACLQVDSRGSPR 85 >SB_41564| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 12 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 50 >SB_39279| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 6 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 44 >SB_36908| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 90 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 23 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 61 >SB_35614| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 58.8 bits (136), Expect = 4e-09 Identities = 29/45 (64%), Positives = 31/45 (68%) Frame = -2 Query: 696 KGECAARRLSWVTPGFSQSRRCKTTAQ*IVIRLTIGRIGYRAPPR 562 KG CAARRLSWVTPGFSQSRRCKTTA + L + G P R Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTASAKLACLQVDSRGSPPPVR 66 >SB_34678| Best HMM Match : Bromodomain (HMM E-Value=9e-25) Length = 1137 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 517 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 555 >SB_34602| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 25 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 63 >SB_34424| Best HMM Match : RNase_U2 (HMM E-Value=7.5) Length = 206 Score = 58.8 bits (136), Expect = 4e-09 Identities = 29/45 (64%), Positives = 32/45 (71%) Frame = -2 Query: 696 KGECAARRLSWVTPGFSQSRRCKTTAQ*IVIRLTIGRIGYRAPPR 562 KG CAARRLSWVTPGFSQSRRCKTTA +L ++ R PR Sbjct: 44 KGGCAARRLSWVTPGFSQSRRCKTTAS---AKLACLQVDSRGSPR 85 >SB_32133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 4 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 42 >SB_31592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 251 Score = 58.8 bits (136), Expect = 4e-09 Identities = 29/45 (64%), Positives = 32/45 (71%) Frame = -2 Query: 696 KGECAARRLSWVTPGFSQSRRCKTTAQ*IVIRLTIGRIGYRAPPR 562 KG CAARRLSWVTPGFSQSRRCKTTA +L ++ R PR Sbjct: 185 KGGCAARRLSWVTPGFSQSRRCKTTAS---AKLACLQVDSRGSPR 226 Score = 57.6 bits (133), Expect = 9e-09 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +2 Query: 620 AVVLQRRDWENPGVTQLNRLAAHSPF 697 AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 50 AVVLQRRDWENPGVTQLNRLAAHPPF 75 >SB_31269| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 4 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 42 >SB_31079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 7 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 45 >SB_30664| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 18 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 56 >SB_29177| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 58.8 bits (136), Expect = 4e-09 Identities = 29/45 (64%), Positives = 32/45 (71%) Frame = -2 Query: 696 KGECAARRLSWVTPGFSQSRRCKTTAQ*IVIRLTIGRIGYRAPPR 562 KG CAARRLSWVTPGFSQSRRCKTTA +L ++ R PR Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS---AKLACLQVDSRGSPR 63 >SB_28552| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 8 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 46 >SB_27244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 73 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 111 >SB_26386| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 20 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 58 >SB_25785| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 190 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 97 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 135 >SB_22440| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 9 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 47 >SB_20758| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 25 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 63 >SB_20651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 29 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 67 >SB_20620| Best HMM Match : zf-HIT (HMM E-Value=8.5e-10) Length = 567 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 581 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRLAAHSPF 697 P+ ++ AVVLQRRDWENPGVTQLNRLAAH PF Sbjct: 186 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 224 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,557,634 Number of Sequences: 59808 Number of extensions: 404705 Number of successful extensions: 4243 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 4116 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4216 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1817559367 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -