BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0652 (697 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY578800-1|AAT07305.1| 379|Anopheles gambiae decapentaplegic pr... 26 1.3 AY146730-1|AAO12090.1| 131|Anopheles gambiae odorant-binding pr... 23 9.2 AJ618929-1|CAF02008.1| 144|Anopheles gambiae odorant-binding pr... 23 9.2 >AY578800-1|AAT07305.1| 379|Anopheles gambiae decapentaplegic protein. Length = 379 Score = 25.8 bits (54), Expect = 1.3 Identities = 13/38 (34%), Positives = 20/38 (52%) Frame = +3 Query: 423 MNLT*ALITSKIIKTYSPTRRTQAYMTPTFSSTGSSLY 536 +N T I ++ +Y+PT +A PT S+ S LY Sbjct: 319 LNTTNHAIVQTLVNSYNPTLAPKACCVPTQLSSISMLY 356 >AY146730-1|AAO12090.1| 131|Anopheles gambiae odorant-binding protein AgamOBP22 protein. Length = 131 Score = 23.0 bits (47), Expect = 9.2 Identities = 11/33 (33%), Positives = 15/33 (45%) Frame = -1 Query: 598 HYRANWVPGPPSRAFVAFSVAYKLDPVDENVGV 500 HYRAN P P + +L+ D+ GV Sbjct: 34 HYRANEFPDDPVTHCFVRCIGLELNLYDDKYGV 66 >AJ618929-1|CAF02008.1| 144|Anopheles gambiae odorant-binding protein OBPjj83b protein. Length = 144 Score = 23.0 bits (47), Expect = 9.2 Identities = 11/33 (33%), Positives = 15/33 (45%) Frame = -1 Query: 598 HYRANWVPGPPSRAFVAFSVAYKLDPVDENVGV 500 HYRAN P P + +L+ D+ GV Sbjct: 47 HYRANEFPDDPVTHCFVRCIGLELNLYDDKYGV 79 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 680,346 Number of Sequences: 2352 Number of extensions: 13844 Number of successful extensions: 19 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 70668195 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -