BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0652 (697 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholi... 24 1.2 DQ026039-1|AAY87898.1| 427|Apis mellifera nicotinic acetylcholi... 24 1.6 AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. 21 8.5 >DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholine receptor beta1subunit protein. Length = 520 Score = 24.2 bits (50), Expect = 1.2 Identities = 15/42 (35%), Positives = 19/42 (45%), Gaps = 1/42 (2%) Frame = -1 Query: 226 REMAARLRYHRHPASFVLRQSLADGXP*T-PSHLPTSLLEER 104 R RLR+ + L S G P P HLPTSL + + Sbjct: 350 RPKKTRLRWMMEIPNVTLPTSTYSGSPTELPKHLPTSLTKSK 391 >DQ026039-1|AAY87898.1| 427|Apis mellifera nicotinic acetylcholine receptor beta2subunit protein. Length = 427 Score = 23.8 bits (49), Expect = 1.6 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -1 Query: 496 YACVLLVGLYVLIIFEVINAYVRFI 422 + C+ LV + +LIIF N Y FI Sbjct: 402 FLCISLVYIIMLIIFIPRNIYENFI 426 >AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. Length = 996 Score = 21.4 bits (43), Expect = 8.5 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = -2 Query: 516 TRMWGSYTP 490 TR WG YTP Sbjct: 500 TRGWGEYTP 508 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 181,994 Number of Sequences: 438 Number of extensions: 3552 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21317625 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -