BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0651 (613 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z73976-8|CAI79223.1| 215|Caenorhabditis elegans Hypothetical pr... 28 4.6 U39666-3|AAA80410.2| 178|Caenorhabditis elegans Hypothetical pr... 27 8.0 AL110477-5|CAB54329.1| 314|Caenorhabditis elegans Hypothetical ... 27 8.0 >Z73976-8|CAI79223.1| 215|Caenorhabditis elegans Hypothetical protein T07C12.14 protein. Length = 215 Score = 28.3 bits (60), Expect = 4.6 Identities = 13/45 (28%), Positives = 23/45 (51%) Frame = +1 Query: 97 KHLVEHEQEEKQWDLLDNYMVAEDPFLGPGKNQKLTLFKEIRSVK 231 +HL + E E K+ D+L ++AE ++ + F+E R K Sbjct: 35 EHLTQEEYERKKTDILRRAVLAESQYIALRTQLRDNKFREAREYK 79 >U39666-3|AAA80410.2| 178|Caenorhabditis elegans Hypothetical protein K04E7.1 protein. Length = 178 Score = 27.5 bits (58), Expect = 8.0 Identities = 16/49 (32%), Positives = 24/49 (48%) Frame = -1 Query: 514 LFSQTNSVFVVHAHVGWLHNSDYFVGHVVFFPPKSVLSEELVAPVGACG 368 L++ + V+V ++ WLH S G+V FP + L LV CG Sbjct: 45 LYAVSFVVYVTNSICSWLHISFVVKGYVTSFPLNTWLVVSLVV-TAVCG 92 >AL110477-5|CAB54329.1| 314|Caenorhabditis elegans Hypothetical protein Y113G7B.7 protein. Length = 314 Score = 27.5 bits (58), Expect = 8.0 Identities = 9/21 (42%), Positives = 16/21 (76%) Frame = +2 Query: 425 EDYVPHEVIRIVEPSYVGMNN 487 +D + EV+R+ +PSY+G +N Sbjct: 268 DDEIEPEVVRLFDPSYIGNDN 288 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,917,537 Number of Sequences: 27780 Number of extensions: 356680 Number of successful extensions: 998 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 977 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 998 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1321669750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -