BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0649 (342 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U31466-1|AAB49040.1| 1433|Homo sapiens nitric oxide synthase pro... 30 1.6 U17327-1|AAA62405.1| 1434|Homo sapiens neuronal nitric oxide syn... 30 1.6 U17326-1|AAB60654.1| 1554|Homo sapiens neuronal nitric oxide syn... 30 1.6 L02881-1|AAA36376.1| 1433|Homo sapiens nitric oxide synthase pro... 30 1.6 D16408-1|BAA03895.1| 1434|Homo sapiens nitric oxide synthase pro... 30 1.6 AY445095-1|AAR07069.1| 1434|Homo sapiens nitric oxide synthase 1... 30 1.6 BC028372-1|AAH28372.1| 790|Homo sapiens ADAM metallopeptidase d... 29 5.0 AY358734-1|AAQ89096.1| 790|Homo sapiens ADAM30 protein. 29 5.0 AL359752-8|CAI18978.1| 790|Homo sapiens ADAM metallopeptidase d... 29 5.0 X76303-1|CAA53950.1| 1203|Homo sapiens endothelial nitric oxide ... 28 8.7 M95296-1|AAA36372.1| 1203|Homo sapiens nitric oxide synthase pro... 28 8.7 M93718-1|AAA36364.1| 1203|Homo sapiens nitric oxide synthase pro... 28 8.7 L26914-1|AAA36374.1| 1203|Homo sapiens nitric oxide synthase pro... 28 8.7 L19267-1|AAA35767.1| 553|Homo sapiens protein ( Homo sapiens 59... 28 8.7 L10709-1|AAA36365.1| 1203|Homo sapiens nitric oxide synthase pro... 28 8.7 D26607-1|BAA05652.1| 1204|Homo sapiens endothelial nitric oxide ... 28 8.7 BC069465-1|AAH69465.1| 1203|Homo sapiens nitric oxide synthase 3... 28 8.7 BC063294-1|AAH63294.1| 1203|Homo sapiens nitric oxide synthase 3... 28 8.7 AK223636-1|BAD97356.1| 1203|Homo sapiens nitric oxide synthase 3... 28 8.7 AF519768-1|AAM74944.1| 1203|Homo sapiens nitric oxide synthase 3... 28 8.7 AF400594-1|AAK83389.1| 1203|Homo sapiens endothelial nitric oxid... 28 8.7 AF171933-1|AAF03781.1| 781|Homo sapiens metallaproteinase-disin... 28 8.7 AF171932-1|AAF03780.1| 790|Homo sapiens metallaproteinase-disin... 28 8.7 AB065836-1|BAC06055.1| 311|Homo sapiens seven transmembrane hel... 28 8.7 >U31466-1|AAB49040.1| 1433|Homo sapiens nitric oxide synthase protein. Length = 1433 Score = 30.3 bits (65), Expect = 1.6 Identities = 13/26 (50%), Positives = 15/26 (57%) Frame = +3 Query: 114 CIIRGSPSHQKLRRPSVCCILWARGT 191 C +RG+PS R P V CIL GT Sbjct: 1230 CFVRGAPSFHLPRNPQVPCILVGPGT 1255 >U17327-1|AAA62405.1| 1434|Homo sapiens neuronal nitric oxide synthase protein. Length = 1434 Score = 30.3 bits (65), Expect = 1.6 Identities = 13/26 (50%), Positives = 15/26 (57%) Frame = +3 Query: 114 CIIRGSPSHQKLRRPSVCCILWARGT 191 C +RG+PS R P V CIL GT Sbjct: 1231 CFVRGAPSFHLPRNPQVPCILVGPGT 1256 >U17326-1|AAB60654.1| 1554|Homo sapiens neuronal nitric oxide synthase protein. Length = 1554 Score = 30.3 bits (65), Expect = 1.6 Identities = 13/26 (50%), Positives = 15/26 (57%) Frame = +3 Query: 114 CIIRGSPSHQKLRRPSVCCILWARGT 191 C +RG+PS R P V CIL GT Sbjct: 1231 CFVRGAPSFHLPRNPQVPCILVGPGT 1256 >L02881-1|AAA36376.1| 1433|Homo sapiens nitric oxide synthase protein. Length = 1433 Score = 30.3 bits (65), Expect = 1.6 Identities = 13/26 (50%), Positives = 15/26 (57%) Frame = +3 Query: 114 CIIRGSPSHQKLRRPSVCCILWARGT 191 C +RG+PS R P V CIL GT Sbjct: 1230 CFVRGAPSFHLPRNPQVPCILVGPGT 1255 >D16408-1|BAA03895.1| 1434|Homo sapiens nitric oxide synthase protein. Length = 1434 Score = 30.3 bits (65), Expect = 1.6 Identities = 13/26 (50%), Positives = 15/26 (57%) Frame = +3 Query: 114 CIIRGSPSHQKLRRPSVCCILWARGT 191 C +RG+PS R P V CIL GT Sbjct: 1231 CFVRGAPSFHLPRNPQVPCILVGPGT 1256 >AY445095-1|AAR07069.1| 1434|Homo sapiens nitric oxide synthase 1 (neuronal) protein. Length = 1434 Score = 30.3 bits (65), Expect = 1.6 Identities = 13/26 (50%), Positives = 15/26 (57%) Frame = +3 Query: 114 CIIRGSPSHQKLRRPSVCCILWARGT 191 C +RG+PS R P V CIL GT Sbjct: 1231 CFVRGAPSFHLPRNPQVPCILVGPGT 1256 >BC028372-1|AAH28372.1| 790|Homo sapiens ADAM metallopeptidase domain 30 protein. Length = 790 Score = 28.7 bits (61), Expect = 5.0 Identities = 14/52 (26%), Positives = 27/52 (51%) Frame = +2 Query: 71 LAPADFTEHHMGHLLHYTREPQSSKATPPQRMLHTLGQGYLAYSAPAYLGYF 226 LAPA ++ H +GH + + + Q + R+ +G G +S +Y+ +F Sbjct: 330 LAPATWSAHELGHAVGMSHDEQYCQCR--GRLNCIMGSGRTGFSNCSYISFF 379 >AY358734-1|AAQ89096.1| 790|Homo sapiens ADAM30 protein. Length = 790 Score = 28.7 bits (61), Expect = 5.0 Identities = 14/52 (26%), Positives = 27/52 (51%) Frame = +2 Query: 71 LAPADFTEHHMGHLLHYTREPQSSKATPPQRMLHTLGQGYLAYSAPAYLGYF 226 LAPA ++ H +GH + + + Q + R+ +G G +S +Y+ +F Sbjct: 330 LAPATWSAHELGHAVGMSHDEQYCQCR--GRLNCIMGSGRTGFSNCSYISFF 379 >AL359752-8|CAI18978.1| 790|Homo sapiens ADAM metallopeptidase domain 30 protein. Length = 790 Score = 28.7 bits (61), Expect = 5.0 Identities = 14/52 (26%), Positives = 27/52 (51%) Frame = +2 Query: 71 LAPADFTEHHMGHLLHYTREPQSSKATPPQRMLHTLGQGYLAYSAPAYLGYF 226 LAPA ++ H +GH + + + Q + R+ +G G +S +Y+ +F Sbjct: 330 LAPATWSAHELGHAVGMSHDEQYCQCR--GRLNCIMGSGRTGFSNCSYISFF 379 >X76303-1|CAA53950.1| 1203|Homo sapiens endothelial nitric oxide synthase protein. Length = 1203 Score = 27.9 bits (59), Expect = 8.7 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = +3 Query: 114 CIIRGSPSHQKLRRPSVCCILWARGT 191 C IRG+PS + PS+ CIL GT Sbjct: 991 CFIRGAPSFRLPPDPSLPCILVGPGT 1016 >M95296-1|AAA36372.1| 1203|Homo sapiens nitric oxide synthase protein. Length = 1203 Score = 27.9 bits (59), Expect = 8.7 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = +3 Query: 114 CIIRGSPSHQKLRRPSVCCILWARGT 191 C IRG+PS + PS+ CIL GT Sbjct: 991 CFIRGAPSFRLPPDPSLPCILVGPGT 1016 >M93718-1|AAA36364.1| 1203|Homo sapiens nitric oxide synthase protein. Length = 1203 Score = 27.9 bits (59), Expect = 8.7 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = +3 Query: 114 CIIRGSPSHQKLRRPSVCCILWARGT 191 C IRG+PS + PS+ CIL GT Sbjct: 991 CFIRGAPSFRLPPDPSLPCILVGPGT 1016 >L26914-1|AAA36374.1| 1203|Homo sapiens nitric oxide synthase protein. Length = 1203 Score = 27.9 bits (59), Expect = 8.7 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = +3 Query: 114 CIIRGSPSHQKLRRPSVCCILWARGT 191 C IRG+PS + PS+ CIL GT Sbjct: 991 CFIRGAPSFRLPPDPSLPCILVGPGT 1016 >L19267-1|AAA35767.1| 553|Homo sapiens protein ( Homo sapiens 59 protein mRNA, 3' end. ). Length = 553 Score = 27.9 bits (59), Expect = 8.7 Identities = 17/49 (34%), Positives = 23/49 (46%), Gaps = 1/49 (2%) Frame = +2 Query: 62 WRPLAPADF-TEHHMGHLLHYTREPQSSKATPPQRMLHTLGQGYLAYSA 205 W P + + F H GHL Y + A PPQ L G+G+ Y+A Sbjct: 99 WLPESESLFLASHASGHLYLYNVSHPCASA-PPQYSLLKQGEGFSVYAA 146 >L10709-1|AAA36365.1| 1203|Homo sapiens nitric oxide synthase protein. Length = 1203 Score = 27.9 bits (59), Expect = 8.7 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = +3 Query: 114 CIIRGSPSHQKLRRPSVCCILWARGT 191 C IRG+PS + PS+ CIL GT Sbjct: 991 CFIRGAPSFRLPPDPSLPCILVGPGT 1016 >D26607-1|BAA05652.1| 1204|Homo sapiens endothelial nitric oxide synthase protein. Length = 1204 Score = 27.9 bits (59), Expect = 8.7 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = +3 Query: 114 CIIRGSPSHQKLRRPSVCCILWARGT 191 C IRG+PS + PS+ CIL GT Sbjct: 991 CFIRGAPSFRLPPDPSLPCILVGPGT 1016 >BC069465-1|AAH69465.1| 1203|Homo sapiens nitric oxide synthase 3 (endothelial cell) protein. Length = 1203 Score = 27.9 bits (59), Expect = 8.7 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = +3 Query: 114 CIIRGSPSHQKLRRPSVCCILWARGT 191 C IRG+PS + PS+ CIL GT Sbjct: 991 CFIRGAPSFRLPPDPSLPCILVGPGT 1016 >BC063294-1|AAH63294.1| 1203|Homo sapiens nitric oxide synthase 3 (endothelial cell) protein. Length = 1203 Score = 27.9 bits (59), Expect = 8.7 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = +3 Query: 114 CIIRGSPSHQKLRRPSVCCILWARGT 191 C IRG+PS + PS+ CIL GT Sbjct: 991 CFIRGAPSFRLPPDPSLPCILVGPGT 1016 >AK223636-1|BAD97356.1| 1203|Homo sapiens nitric oxide synthase 3 (endothelial cell) variant protein. Length = 1203 Score = 27.9 bits (59), Expect = 8.7 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = +3 Query: 114 CIIRGSPSHQKLRRPSVCCILWARGT 191 C IRG+PS + PS+ CIL GT Sbjct: 991 CFIRGAPSFRLPPDPSLPCILVGPGT 1016 >AF519768-1|AAM74944.1| 1203|Homo sapiens nitric oxide synthase 3 (endothelial cell) protein. Length = 1203 Score = 27.9 bits (59), Expect = 8.7 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = +3 Query: 114 CIIRGSPSHQKLRRPSVCCILWARGT 191 C IRG+PS + PS+ CIL GT Sbjct: 991 CFIRGAPSFRLPPDPSLPCILVGPGT 1016 >AF400594-1|AAK83389.1| 1203|Homo sapiens endothelial nitric oxide synthase protein. Length = 1203 Score = 27.9 bits (59), Expect = 8.7 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = +3 Query: 114 CIIRGSPSHQKLRRPSVCCILWARGT 191 C IRG+PS + PS+ CIL GT Sbjct: 991 CFIRGAPSFRLPPDPSLPCILVGPGT 1016 >AF171933-1|AAF03781.1| 781|Homo sapiens metallaproteinase-disintegrin beta protein. Length = 781 Score = 27.9 bits (59), Expect = 8.7 Identities = 14/52 (26%), Positives = 26/52 (50%) Frame = +2 Query: 71 LAPADFTEHHMGHLLHYTREPQSSKATPPQRMLHTLGQGYLAYSAPAYLGYF 226 LAPA + H +GH + + + Q + R+ +G G +S +Y+ +F Sbjct: 330 LAPATWPAHELGHAVGMSHDEQYCQCR--GRLNCIMGSGRTGFSNCSYISFF 379 >AF171932-1|AAF03780.1| 790|Homo sapiens metallaproteinase-disintegrin protein. Length = 790 Score = 27.9 bits (59), Expect = 8.7 Identities = 13/52 (25%), Positives = 26/52 (50%) Frame = +2 Query: 71 LAPADFTEHHMGHLLHYTREPQSSKATPPQRMLHTLGQGYLAYSAPAYLGYF 226 LAPA ++ H +GH + + + Q + + +G G +S +Y+ +F Sbjct: 330 LAPATWSAHELGHAVGMSHDEQYCQCRGRPNCI--MGSGRTGFSNCSYISFF 379 >AB065836-1|BAC06055.1| 311|Homo sapiens seven transmembrane helix receptor protein. Length = 311 Score = 27.9 bits (59), Expect = 8.7 Identities = 11/31 (35%), Positives = 20/31 (64%) Frame = +1 Query: 178 GPGVLSILCTSLLRILWTSLLSICRTSLLRH 270 GP V+S + S + ++W S L C ++++RH Sbjct: 146 GPYVISFI-NSFVNVVWMSRLHFCDSNVVRH 175 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 52,817,888 Number of Sequences: 237096 Number of extensions: 988541 Number of successful extensions: 2262 Number of sequences better than 10.0: 24 Number of HSP's better than 10.0 without gapping: 2229 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2262 length of database: 76,859,062 effective HSP length: 80 effective length of database: 57,891,382 effective search space used: 1910415606 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -