BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0644 (571 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_29025| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 3e-27 SB_31440| Best HMM Match : 2-oxoacid_dh (HMM E-Value=3.5e-14) 73 2e-13 SB_42465| Best HMM Match : 2-oxoacid_dh (HMM E-Value=0) 61 7e-10 SB_10000| Best HMM Match : 2-oxoacid_dh (HMM E-Value=0) 55 4e-08 SB_16687| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 2e-05 SB_42560| Best HMM Match : ig (HMM E-Value=2.4e-06) 32 0.38 SB_9657| Best HMM Match : P_proprotein (HMM E-Value=7.5e-29) 31 0.66 SB_45482| Best HMM Match : BTB (HMM E-Value=5.6e-11) 31 0.88 SB_4199| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.88 SB_33046| Best HMM Match : RRM_1 (HMM E-Value=3.6e-13) 31 0.88 SB_49054| Best HMM Match : Chordopox_A30L (HMM E-Value=4.1) 30 1.2 SB_19407| Best HMM Match : SURF6 (HMM E-Value=0.43) 30 1.2 SB_42994| Best HMM Match : NHL (HMM E-Value=8.4e-34) 30 1.5 SB_51402| Best HMM Match : Peptidase_M13_N (HMM E-Value=1.9e-12) 29 2.0 SB_29969| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.0 SB_36761| Best HMM Match : DUF1279 (HMM E-Value=0.23) 29 2.7 SB_7376| Best HMM Match : ELO (HMM E-Value=3.3e-07) 29 3.5 SB_45720| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_47024| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.7 SB_43387| Best HMM Match : DUF1103 (HMM E-Value=1.5e-07) 28 4.7 SB_53470| Best HMM Match : E-MAP-115 (HMM E-Value=7.6) 28 4.7 SB_19464| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.7 SB_29861| Best HMM Match : RRM_1 (HMM E-Value=1.10002e-42) 28 6.2 SB_24457| Best HMM Match : TPR_2 (HMM E-Value=1.4e-16) 28 6.2 SB_20853| Best HMM Match : F-box (HMM E-Value=1.1e-05) 27 8.2 SB_11721| Best HMM Match : Peptidase_C12 (HMM E-Value=0) 27 8.2 SB_10587| Best HMM Match : DGCR6 (HMM E-Value=8.6e-07) 27 8.2 >SB_29025| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 431 Score = 118 bits (284), Expect = 3e-27 Identities = 70/139 (50%), Positives = 85/139 (61%), Gaps = 3/139 (2%) Frame = +2 Query: 125 IAGTRTEQRVKMNRGRQRIAQRLKDAQNTNAMLTTFNEIDMSHIMAFRKKHLDTFTKKHS 304 + G R+E RVKMNR R RIA RLKD+QNT AMLTTFN+IDMS+IM R+ + D F KKH Sbjct: 198 LQGARSEHRVKMNRMRLRIASRLKDSQNTYAMLTTFNDIDMSNIMEMRQTYKDAFFKKHG 257 Query: 305 IKLGLMSPFVKAAANALMDQPVVNAVIE-ENEIIYRDYVDISVAVATPKGLVVPVIRNVQ 481 +KLG MS FVKAAA AL PVVNA E + +II V +A G+VV V+ Sbjct: 258 LKLGFMSAFVKAAAYALESLPVVNAACETQIKIIITKGQSALVLLAVCTGVVVDRTFQVE 317 Query: 482 --NMTYADIRAHHSWASGK 532 M Y + H G+ Sbjct: 318 IRPMMYVALTYDHRLIDGR 336 >SB_31440| Best HMM Match : 2-oxoacid_dh (HMM E-Value=3.5e-14) Length = 107 Score = 72.9 bits (171), Expect = 2e-13 Identities = 33/53 (62%), Positives = 43/53 (81%) Frame = +2 Query: 383 IEENEIIYRDYVDISVAVATPKGLVVPVIRNVQNMTYADIRAHHSWASGKSEN 541 IE+N+I+YRDYVDISVAV+TPKGLVVPV+RNV++M +ADI + K+ N Sbjct: 2 IEDNQIVYRDYVDISVAVSTPKGLVVPVLRNVESMNFADIEKAINALGEKARN 54 >SB_42465| Best HMM Match : 2-oxoacid_dh (HMM E-Value=0) Length = 441 Score = 60.9 bits (141), Expect = 7e-10 Identities = 39/116 (33%), Positives = 70/116 (60%), Gaps = 3/116 (2%) Frame = +2 Query: 143 EQRVKMNRG-RQRIAQRLKDAQNTNAMLTTFNEIDMSHIMAFRKKHLDTFTKKHSIKLGL 319 E RV+ +G R+ +A+ + A N +EI ++ ++ F KKH++ ++ +KL Sbjct: 209 EDRVENIKGIRKAMAKTMTAALNI-PHFGYCDEILLNELVDF-KKHINPMLEQRGVKLSF 266 Query: 320 MSPFVKAAANALMDQPVVNAVI--EENEIIYRDYVDISVAVATPKGLVVPVIRNVQ 481 M F+KAA+ AL P++N+ + E +I ++ +I +A+ TP+GLVVP ++NVQ Sbjct: 267 MPLFIKAASMALQQFPILNSSVDPECTKITFKAAHNIGLAMDTPQGLVVPNVKNVQ 322 >SB_10000| Best HMM Match : 2-oxoacid_dh (HMM E-Value=0) Length = 382 Score = 55.2 bits (127), Expect = 4e-08 Identities = 44/160 (27%), Positives = 72/160 (45%), Gaps = 1/160 (0%) Frame = +2 Query: 68 AQAIETATVKVPPQDYSKEIAGTRTEQRVKMNRGRQRIAQRLKDAQNTNAMLTTFNEIDM 247 A + ++ K PQ + T V R+ IA+RL ++ T + + M Sbjct: 138 APPVVSSARKAVPQPVTPATPSPGTFTDVPNTEMRREIAKRLLKSKTTIPHVYASTDCVM 197 Query: 248 SHIMAFRKKHLDTFTKKHSIKLGLMSPFVKAAANALMDQPVVNAVIEENEIIYRDYVDIS 427 +++ K HL K+ + + + VK AA L P +NAV EI Y +D++ Sbjct: 198 DNLLQL-KSHL----KERGVTVSVNDLLVKVAAVCLRKVPEMNAVWNGKEIEYLKDIDLA 252 Query: 428 VAVATPKGLVVPVIRNVQNMTYADIR-AHHSWASGKSENR 544 V VAT G++ PVIRN + + I H A+ +N+ Sbjct: 253 VDVATDVGIITPVIRNAAYLDLSQISLVAHDIATRARDNK 292 >SB_16687| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 407 Score = 46.0 bits (104), Expect = 2e-05 Identities = 38/132 (28%), Positives = 61/132 (46%) Frame = +2 Query: 74 AIETATVKVPPQDYSKEIAGTRTEQRVKMNRGRQRIAQRLKDAQNTNAMLTTFNEIDMSH 253 A A P + I GT E + ++ RQ IA+RL ++ T ++ M Sbjct: 182 AASAALAAQPTPVAAAPIPGTVYED-IPLSNMRQVIAKRLLQSKQTIPHYYLSVDVKMDQ 240 Query: 254 IMAFRKKHLDTFTKKHSIKLGLMSPFVKAAANALMDQPVVNAVIEENEIIYRDYVDISVA 433 ++ RK+ + K S KL + VK+ A A P N+ + I + VD+SVA Sbjct: 241 LIEIRKQLNEQ--GKGSYKLSINDFIVKSCALACRQVPEANSSWMGDFIRRYENVDVSVA 298 Query: 434 VATPKGLVVPVI 469 V+T GL+ P++ Sbjct: 299 VSTDNGLITPIV 310 >SB_42560| Best HMM Match : ig (HMM E-Value=2.4e-06) Length = 360 Score = 31.9 bits (69), Expect = 0.38 Identities = 26/131 (19%), Positives = 48/131 (36%), Gaps = 4/131 (3%) Frame = +1 Query: 109 GLQQRDRRHAHRATGQDEQGEATHRSAFEGRSEHERHVDDIQRDRHVPHHGIP*EAPRHL 288 G +D+ ++ G+ QGE + EH +H + H H G P + + Sbjct: 223 GKPNQDQGQHNKHCGKPNQGEHNKHCGKPNQGEHNKHCGKPNQGEHNKHCGKPNQGEHNK 282 Query: 289 H*EAQHQTRSDVTF---REGGRQRPDG-PARGERCYRRKRDNL*GLRRYFGSGRHTERSR 456 H +Q + +G + G P +GE + N ++ G E ++ Sbjct: 283 HCGKPNQGEHNKHCGKPNQGEHNKHCGKPNQGEHNKHCGKPNQGQHNKHCGKPNQGEHNK 342 Query: 457 RAGHQKRSEHD 489 G + EH+ Sbjct: 343 HCGKPNQGEHN 353 Score = 28.7 bits (61), Expect = 3.5 Identities = 23/113 (20%), Positives = 41/113 (36%) Frame = +1 Query: 151 GQDEQGEATHRSAFEGRSEHERHVDDIQRDRHVPHHGIP*EAPRHLH*EAQHQTRSDVTF 330 G+ QGE + EH +H + H H G P + + H +Q + Sbjct: 175 GKPNQGEHNKHCGKPNQGEHNKHCGKPNQGEHNKHCGKPNQGEHNKHCGKPNQDQGQHN- 233 Query: 331 REGGRQRPDGPARGERCYRRKRDNL*GLRRYFGSGRHTERSRRAGHQKRSEHD 489 + G+ P +GE + N ++ G E ++ G + EH+ Sbjct: 234 KHCGK-----PNQGEHNKHCGKPNQGEHNKHCGKPNQGEHNKHCGKPNQGEHN 281 Score = 28.3 bits (60), Expect = 4.7 Identities = 25/127 (19%), Positives = 45/127 (35%), Gaps = 1/127 (0%) Frame = +1 Query: 112 LQQRDRRH-AHRATGQDEQGEATHRSAFEGRSEHERHVDDIQRDRHVPHHGIP*EAPRHL 288 L++ R H H + QGE + EH +H + H H G P + + Sbjct: 149 LRRVTRTHNKHCGKPRPNQGEHNKHCGKPNQGEHNKHCGKPNQGEHNKHCGKPNQGEHNK 208 Query: 289 H*EAQHQTRSDVTFREGGRQRPDGPARGERCYRRKRDNL*GLRRYFGSGRHTERSRRAGH 468 H +Q + + G+ D + C + N ++ G E ++ G Sbjct: 209 HCGKPNQGEHN---KHCGKPNQDQGQHNKHC---GKPNQGEHNKHCGKPNQGEHNKHCGK 262 Query: 469 QKRSEHD 489 + EH+ Sbjct: 263 PNQGEHN 269 >SB_9657| Best HMM Match : P_proprotein (HMM E-Value=7.5e-29) Length = 1779 Score = 31.1 bits (67), Expect = 0.66 Identities = 19/75 (25%), Positives = 30/75 (40%) Frame = +1 Query: 34 HLLNTSRRHPSRSGDRDSNC*SSSTGLQQRDRRHAHRATGQDEQGEATHRSAFEGRSEHE 213 H ++ RH R S+ + + + Q + H G+ G +S R++H Sbjct: 289 HAKKSTGRHQKSVYQRKSDAKNRNISVNQIKTANKHETFGRQRHG--LRQSKKHHRNKHY 346 Query: 214 RHVDDIQRDRHVPHH 258 RH D RH HH Sbjct: 347 RHHDRNHHHRHHHHH 361 >SB_45482| Best HMM Match : BTB (HMM E-Value=5.6e-11) Length = 3037 Score = 30.7 bits (66), Expect = 0.88 Identities = 22/72 (30%), Positives = 35/72 (48%), Gaps = 5/72 (6%) Frame = +2 Query: 149 RVKMNRGRQRIAQRLKDAQNTNAMLTTF--NEIDMSHIMAFRKKHLD---TFTKKHSIKL 313 +VKM++ +++ K +A TF N DM+ + R++HL+ T K S Sbjct: 1462 QVKMHKTKEQQCNVEKTLPEESAQKRTFVKNRTDMASSLNIRRRHLEDSKTLEKSKSFSS 1521 Query: 314 GLMSPFVKAAAN 349 GL P V AA+ Sbjct: 1522 GLDVPVVDNAAD 1533 >SB_4199| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 30.7 bits (66), Expect = 0.88 Identities = 32/120 (26%), Positives = 44/120 (36%) Frame = +1 Query: 130 RHAHRATGQDEQGEATHRSAFEGRSEHERHVDDIQRDRHVPHHGIP*EAPRHLH*EAQHQ 309 RH + + H S S HER + R PH E RH E Sbjct: 8 RHKTKQHETSRHERSRHESNRHKTSRHERSRHETSRHESSPHETSRHETSRH---ETSRH 64 Query: 310 TRSDVTFREGGRQRPDGPARGERCYRRKRDNL*GLRRYFGSGRHTERSRRAGHQKRSEHD 489 RS R+ R R +R E R + + G R+ S T R R+ H+ R +H+ Sbjct: 65 ERSRHETRQHERSR-HKTSRHES--SRHKTSRHGRSRHKTSRHETSRHERSRHETR-QHE 120 Score = 29.1 bits (62), Expect = 2.7 Identities = 28/132 (21%), Positives = 47/132 (35%), Gaps = 4/132 (3%) Frame = +1 Query: 106 TGLQQRDRRHAHR-ATGQDEQGE---ATHRSAFEGRSEHERHVDDIQRDRHVPHHGIP*E 273 T +R R ++R T + E+ + H S+ S HE + R H E Sbjct: 16 TSRHERSRHESNRHKTSRHERSRHETSRHESSPHETSRHETSRHETSRHERSRHETRQHE 75 Query: 274 APRHLH*EAQHQTRSDVTFREGGRQRPDGPARGERCYRRKRDNL*GLRRYFGSGRHTERS 453 RH ++H++ T R G + R R + + R + RH + Sbjct: 76 RSRHK--TSRHESSRHKTSRHGRSRHKTSRHETSRHERSRHETRQHERSRHKTSRHEKSR 133 Query: 454 RRAGHQKRSEHD 489 +RS H+ Sbjct: 134 HETSRHERSRHE 145 Score = 28.7 bits (61), Expect = 3.5 Identities = 24/94 (25%), Positives = 34/94 (36%) Frame = +1 Query: 46 TSRRHPSRSGDRDSNC*SSSTGLQQRDRRHAHRATGQDEQGEATHRSAFEGRSEHERHVD 225 TSR SR R T + RH G+ + H ++ RS HE Sbjct: 61 TSRHERSRHETRQHERSRHKTS-RHESSRHKTSRHGRSRHKTSRHETSRHERSRHETRQH 119 Query: 226 DIQRDRHVPHHGIP*EAPRHLH*EAQHQTRSDVT 327 + R + H E RH ++H+TR T Sbjct: 120 ERSRHKTSRHEKSRHETSRHE--RSRHETRQHET 151 >SB_33046| Best HMM Match : RRM_1 (HMM E-Value=3.6e-13) Length = 1463 Score = 30.7 bits (66), Expect = 0.88 Identities = 32/121 (26%), Positives = 46/121 (38%) Frame = +1 Query: 127 RRHAHRATGQDEQGEATHRSAFEGRSEHERHVDDIQRDRHVPHHGIP*EAPRHLH*EAQH 306 RRH + Q + S F R E + D Q P H ++PR H Sbjct: 401 RRHLREEERRLSQTQENRDSKF--RPESDDPSDKNQHRERSPGHRRRSQSPRRRSRSPGH 458 Query: 307 QTRSDVTFREGGRQRPDGPARGERCYRRKRDNL*GLRRYFGSGRHTERSRRAGHQKRSEH 486 ++RS R+ R R G R +R R RD GR +R + GH++ + Sbjct: 459 RSRSPRRGRD--RDRDRGRDRRDRDRDRDRDR--------DRGRDRDRDKDKGHERPKDR 508 Query: 487 D 489 D Sbjct: 509 D 509 >SB_49054| Best HMM Match : Chordopox_A30L (HMM E-Value=4.1) Length = 432 Score = 30.3 bits (65), Expect = 1.2 Identities = 17/59 (28%), Positives = 27/59 (45%) Frame = +1 Query: 67 RSGDRDSNC*SSSTGLQQRDRRHAHRATGQDEQGEATHRSAFEGRSEHERHVDDIQRDR 243 RSGDR+ + ++R RRH +G D + E + A + R DD ++ R Sbjct: 157 RSGDREKSDREKEREKERRRRRHEDEGSG-DRRRERRDKDAHDPEDPKRREKDDKKKSR 214 >SB_19407| Best HMM Match : SURF6 (HMM E-Value=0.43) Length = 443 Score = 30.3 bits (65), Expect = 1.2 Identities = 16/35 (45%), Positives = 23/35 (65%) Frame = +2 Query: 107 QDYSKEIAGTRTEQRVKMNRGRQRIAQRLKDAQNT 211 Q +K IAG R QR++ RGR+R QR+++ Q T Sbjct: 310 QRLNKRIAGVR--QRLESLRGRKRKLQRMREEQET 342 >SB_42994| Best HMM Match : NHL (HMM E-Value=8.4e-34) Length = 750 Score = 29.9 bits (64), Expect = 1.5 Identities = 17/66 (25%), Positives = 27/66 (40%) Frame = +1 Query: 16 GTRRCSHLLNTSRRHPSRSGDRDSNC*SSSTGLQQRDRRHAHRATGQDEQGEATHRSAFE 195 G S + T H R G+ + S+ R H ++ DE+ + H S F Sbjct: 402 GHSESSQSVKTIGDHSRRYGNENDYTDSAGDRKASRFGAHNEASSTFDEKNKEDHSSRFH 461 Query: 196 GRSEHE 213 G+ +HE Sbjct: 462 GKKDHE 467 >SB_51402| Best HMM Match : Peptidase_M13_N (HMM E-Value=1.9e-12) Length = 1206 Score = 29.5 bits (63), Expect = 2.0 Identities = 21/57 (36%), Positives = 25/57 (43%), Gaps = 2/57 (3%) Frame = +1 Query: 97 SSSTGLQQRDRRHAHRATGQDEQGEATHRSAFEGRSEH--ERHVDDIQRDRHVPHHG 261 S +TG+ R H TGQD Q E TH S E R + + RD V HG Sbjct: 880 SENTGIDARFGFHGSERTGQDAQFE-THGSGREVRDARICTHEMGRMARDAQVGTHG 935 >SB_29969| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 281 Score = 29.5 bits (63), Expect = 2.0 Identities = 15/41 (36%), Positives = 22/41 (53%) Frame = +1 Query: 40 LNTSRRHPSRSGDRDSNC*SSSTGLQQRDRRHAHRATGQDE 162 +N +R H GDR + G+++R+R H H T QDE Sbjct: 166 INAARYHRC-VGDRGDGGIYETPGIRRRERFHGHDVTTQDE 205 >SB_36761| Best HMM Match : DUF1279 (HMM E-Value=0.23) Length = 244 Score = 29.1 bits (62), Expect = 2.7 Identities = 14/49 (28%), Positives = 29/49 (59%), Gaps = 1/49 (2%) Frame = +1 Query: 97 SSSTGLQQRDRRHAH-RATGQDEQGEATHRSAFEGRSEHERHVDDIQRD 240 ++S+ +Q+RDR+ A R Q + E++ + A E E +D+++R+ Sbjct: 6 TTSSVMQERDRKAAEKRVQRQKDTQESSRQEARERNEERLSEIDELERE 54 >SB_7376| Best HMM Match : ELO (HMM E-Value=3.3e-07) Length = 278 Score = 28.7 bits (61), Expect = 3.5 Identities = 14/38 (36%), Positives = 20/38 (52%) Frame = -2 Query: 306 MLCFLVKVSRCFLRNAMMWDMSISLNVVNMAFVF*ASF 193 M F+VKV F+ N WD+ L V N A V +++ Sbjct: 40 MYLFIVKVGPKFMENRKAWDLRGVLVVYNFALVLLSAY 77 >SB_45720| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 245 Score = 28.7 bits (61), Expect = 3.5 Identities = 26/119 (21%), Positives = 41/119 (34%) Frame = +1 Query: 133 HAHRATGQDEQGEATHRSAFEGRSEHERHVDDIQRDRHVPHHGIP*EAPRHLH*EAQHQT 312 H + ++G S R E H+D R R E P HL + + Sbjct: 38 HLETTMRRRKEGPIHLDSTMRRRREGPIHLDTTMRRRR--------EGPIHLDSTMRRRR 89 Query: 313 RSDVTFREGGRQRPDGPARGERCYRRKRDNL*GLRRYFGSGRHTERSRRAGHQKRSEHD 489 + R+R +GP + RR+R+ + G+H E R H H+ Sbjct: 90 EGPIHLDSTMRRRREGPIHLDSTMRRRREGV------HPPGQHHEEEERGAHPPGQHHE 142 >SB_47024| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 975 Score = 28.3 bits (60), Expect = 4.7 Identities = 21/86 (24%), Positives = 35/86 (40%), Gaps = 5/86 (5%) Frame = +1 Query: 115 QQRDRRHAHRATGQDEQGEATHRSAF-----EGRSEHERHVDDIQRDRHVPHHGIP*EAP 279 ++R+R R + E+ + H A E R ER + ++QR H + E Sbjct: 722 EKREREIREREEREWEENKRKHEEARLQREREAREREERELRELQRREEEEHESLAREEG 781 Query: 280 RHLH*EAQHQTRSDVTFREGGRQRPD 357 E+Q + DV +E + PD Sbjct: 782 ERAERESQREAGRDV--KEEDSKEPD 805 >SB_43387| Best HMM Match : DUF1103 (HMM E-Value=1.5e-07) Length = 644 Score = 28.3 bits (60), Expect = 4.7 Identities = 13/51 (25%), Positives = 20/51 (39%) Frame = +1 Query: 139 HRATGQDEQGEATHRSAFEGRSEHERHVDDIQRDRHVPHHGIP*EAPRHLH 291 + AT D + TH + + H D +D H+ H P H+H Sbjct: 12 YTATDPDNKDHHTHNKGPDNKDHHTHSKDPDNKDHHI-HSKDPDNKDHHIH 61 >SB_53470| Best HMM Match : E-MAP-115 (HMM E-Value=7.6) Length = 192 Score = 28.3 bits (60), Expect = 4.7 Identities = 17/77 (22%), Positives = 26/77 (33%) Frame = +1 Query: 55 RHPSRSGDRDSNC*SSSTGLQQRDRRHAHRATGQDEQGEATHRSAFEGRSEHERHVDDIQ 234 RH + D + + DR R ++E R+ E H+ +D + Sbjct: 110 RHDEERNNEDEDRHDEERNNEHEDRHDKGRNDDEEEDRHDGERNDDEEEDRHDEERNDDE 169 Query: 235 RDRHVPHHGIP*EAPRH 285 DRH E RH Sbjct: 170 EDRHDEKRNEDEEEDRH 186 Score = 27.5 bits (58), Expect = 8.2 Identities = 23/107 (21%), Positives = 32/107 (29%) Frame = +1 Query: 55 RHPSRSGDRDSNC*SSSTGLQQRDRRHAHRATGQDEQGEATHRSAFEGRSEHERHVDDIQ 234 RH D D + + D RH +DE G R+ E H+ ++ Sbjct: 26 RHDEERNDEDEDRHDEERNNEHED-RHDEERNDEDEDGHDEERNN-EHEDRHDEERNNEH 83 Query: 235 RDRHVPHHGIP*EAPRHLH*EAQHQTRSDVTFREGGRQRPDGPARGE 375 DRH E +H+ R D R D E Sbjct: 84 EDRHDEERNNEEEDKHDEERNNEHEDRHDEERNNEDEDRHDEERNNE 130 >SB_19464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1653 Score = 28.3 bits (60), Expect = 4.7 Identities = 14/44 (31%), Positives = 23/44 (52%), Gaps = 2/44 (4%) Frame = +1 Query: 121 RDRRHAHRATGQDEQGEATHRSAFEGRSEHERHVDDIQR--DRH 246 R+R R+ +D++ +++ RS E H H D +R DRH Sbjct: 308 RERERRDRSIPRDDRLDSSRRSRHEDERSHSSHQDRHERESDRH 351 Score = 28.3 bits (60), Expect = 4.7 Identities = 36/142 (25%), Positives = 51/142 (35%) Frame = +1 Query: 61 PSRSGDRDSNC*SSSTGLQQRDRRHAHRATGQDEQGEATHRSAFEGRSEHERHVDDIQRD 240 P R DR S+ ++RDR R +D + HR + E D +RD Sbjct: 747 PDREDDRASDISRDREEREKRDREDRDRRDREDRE----HREREDRERERRDREDRERRD 802 Query: 241 RHVPHHGIP*EAPRHLH*EAQHQTRSDVTFREGGRQRPDGPARGERCYRRKRDNL*GLRR 420 R + R + + + R D RE R+ + R E+ KRD RR Sbjct: 803 RDERDRRDREDRERRDREDRERRDRED---RERERREREDRERREKEEFDKRDR---ERR 856 Query: 421 YFGSGRHTERSRRAGHQKRSEH 486 R E R +R EH Sbjct: 857 EKDDRRPREDDRERVRGRREEH 878 >SB_29861| Best HMM Match : RRM_1 (HMM E-Value=1.10002e-42) Length = 1531 Score = 27.9 bits (59), Expect = 6.2 Identities = 27/103 (26%), Positives = 36/103 (34%) Frame = +1 Query: 178 HRSAFEGRSEHERHVDDIQRDRHVPHHGIP*EAPRHLH*EAQHQTRSDVTFREGGRQRPD 357 HR +EG HE DD + ++ E R E +H R EG Sbjct: 488 HRDNYEGGPGHEYESDDFDQQLKEYNYRRQREREREREREGRHMDRGPRDRHEGDYTEVT 547 Query: 358 GPARGERCYRRKRDNL*GLRRYFGSGRHTERSRRAGHQKRSEH 486 G G R + RD G R G + + H K S+H Sbjct: 548 G---GSRWSQGDRDRDRGPDRESSVGSYDDEREPRDH-KPSQH 586 >SB_24457| Best HMM Match : TPR_2 (HMM E-Value=1.4e-16) Length = 1134 Score = 27.9 bits (59), Expect = 6.2 Identities = 24/97 (24%), Positives = 47/97 (48%), Gaps = 3/97 (3%) Frame = +2 Query: 116 SKEIAGTRTEQRVKMNRGRQRIAQRLKDAQNTNAMLTTFNEIDMSHIMAFRKKHLDTFTK 295 ++ ++ T E ++ R R K + T ++ID I+ + L+T+++ Sbjct: 2 ARRVSRTALENEIERARVEGRWESLSKLVEQLCTRTTQESQIDSLKILLLAEADLETYSR 61 Query: 296 KHSIKLGLMSPFVKAAANALMDQPVV---NAVIEENE 397 HS+ + ++AA +AL +PVV N VI+E + Sbjct: 62 DHSLDVN----DLRAARSAL--EPVVTKLNNVIQERK 92 >SB_20853| Best HMM Match : F-box (HMM E-Value=1.1e-05) Length = 637 Score = 27.5 bits (58), Expect = 8.2 Identities = 11/21 (52%), Positives = 16/21 (76%) Frame = -3 Query: 86 LSRSPERDGWRRLVLRRWEQR 24 +S++P WRRLVLRRW+ + Sbjct: 34 ISKTPSL--WRRLVLRRWQSQ 52 >SB_11721| Best HMM Match : Peptidase_C12 (HMM E-Value=0) Length = 537 Score = 27.5 bits (58), Expect = 8.2 Identities = 14/25 (56%), Positives = 17/25 (68%) Frame = +3 Query: 231 STRSTCPTSWHSVRSTSTPSLRSTA 305 +T ST S+ SV +TSTPSL S A Sbjct: 296 TTCSTVSLSFSSVTATSTPSLESVA 320 >SB_10587| Best HMM Match : DGCR6 (HMM E-Value=8.6e-07) Length = 423 Score = 27.5 bits (58), Expect = 8.2 Identities = 7/20 (35%), Positives = 17/20 (85%) Frame = +1 Query: 199 RSEHERHVDDIQRDRHVPHH 258 R ++++H ++I++++H PHH Sbjct: 164 RVQYKKHKEEIEKNQHRPHH 183 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,417,045 Number of Sequences: 59808 Number of extensions: 353937 Number of successful extensions: 1260 Number of sequences better than 10.0: 27 Number of HSP's better than 10.0 without gapping: 1095 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1244 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1349364063 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -