BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0643 (434 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_04_1507 + 34056434-34056502,34056724-34057161,34057237-34057881 28 3.8 02_01_0752 - 5583757-5584092 27 8.7 >04_04_1507 + 34056434-34056502,34056724-34057161,34057237-34057881 Length = 383 Score = 27.9 bits (59), Expect = 3.8 Identities = 18/60 (30%), Positives = 29/60 (48%) Frame = -1 Query: 191 NSLYILLPHNEPIKHQEQESGRTTIRSNPSDACFHHFLFICLQRRIPLGVTSYDLNWLAR 12 N+L+ LLPH E GR + FH LF +R I + +++ L+WL++ Sbjct: 112 NTLFGLLPHRGAASSGEGGRGRRHYFAAAVPGSFHDRLF--PERSIDVFTSTFCLHWLSQ 169 >02_01_0752 - 5583757-5584092 Length = 111 Score = 26.6 bits (56), Expect = 8.7 Identities = 18/45 (40%), Positives = 22/45 (48%) Frame = +1 Query: 37 DVTPSGIRRCRQINKKWWKHASDGFDRIVVLPDSCS*CLIGSLWG 171 +V P+G RR R WW ASD +I L D + GS WG Sbjct: 3 NVPPAGGRRQRA----WWWGASDTDTQIQALTDGYNVGEGGSYWG 43 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,320,694 Number of Sequences: 37544 Number of extensions: 204594 Number of successful extensions: 455 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 450 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 455 length of database: 14,793,348 effective HSP length: 75 effective length of database: 11,977,548 effective search space used: 826450812 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -