BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0640 (538 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_32986| Best HMM Match : Ribosomal_S15 (HMM E-Value=7.2) 27 7.3 SB_10406| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.3 SB_1197| Best HMM Match : DUF1580 (HMM E-Value=6) 27 7.3 SB_48759| Best HMM Match : Ribosomal_S15 (HMM E-Value=8.1) 27 9.7 SB_42350| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 >SB_32986| Best HMM Match : Ribosomal_S15 (HMM E-Value=7.2) Length = 331 Score = 27.5 bits (58), Expect = 7.3 Identities = 11/24 (45%), Positives = 13/24 (54%) Frame = -3 Query: 530 KNNNGKWFLPIHARKNVYPQPENK 459 KN NG W P+ R N P+NK Sbjct: 76 KNENGNWEAPLPFRANEVHLPDNK 99 >SB_10406| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 268 Score = 27.5 bits (58), Expect = 7.3 Identities = 8/32 (25%), Positives = 15/32 (46%) Frame = +2 Query: 92 WFLTNDTRWAVDESQRPSSCQDXGVDKLKDLP 187 WF +W DE Q+ C + ++++P Sbjct: 217 WFQNRRMKWKKDEKQKTEDCYSAHQENIEEIP 248 >SB_1197| Best HMM Match : DUF1580 (HMM E-Value=6) Length = 282 Score = 27.5 bits (58), Expect = 7.3 Identities = 11/24 (45%), Positives = 13/24 (54%) Frame = -3 Query: 530 KNNNGKWFLPIHARKNVYPQPENK 459 KN NG W P+ R N P+NK Sbjct: 224 KNENGNWEAPLPFRANEVHLPDNK 247 >SB_48759| Best HMM Match : Ribosomal_S15 (HMM E-Value=8.1) Length = 337 Score = 27.1 bits (57), Expect = 9.7 Identities = 11/24 (45%), Positives = 13/24 (54%) Frame = -3 Query: 530 KNNNGKWFLPIHARKNVYPQPENK 459 KN NG W P+ R N P+NK Sbjct: 117 KNENGNWEAPLPFRANDVHLPDNK 140 >SB_42350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 414 Score = 27.1 bits (57), Expect = 9.7 Identities = 10/30 (33%), Positives = 18/30 (60%) Frame = -3 Query: 389 LITKIVNTLLNHASHLFSSFVVHTMFCHNF 300 L+ ++++L H F S +H++FC NF Sbjct: 277 LVGARIHSILGVRIHSFVSVRIHSLFCRNF 306 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,069,011 Number of Sequences: 59808 Number of extensions: 296185 Number of successful extensions: 808 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 748 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 806 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1215643300 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -