BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0637 (408 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC2F7.06c |pol4||DNA polymerase X family|Schizosaccharomyces p... 27 1.5 SPAC3H8.03 |||mitochondrial ribosomal protein subunit Img2|Schiz... 25 6.0 SPAP8A3.12c |||tripeptidylpeptidase |Schizosaccharomyces pombe|c... 25 6.0 SPAC32A11.02c |||conserved fungal protein|Schizosaccharomyces po... 24 7.9 SPBC3F6.05 |rga1||GTPase activating protein Rga1|Schizosaccharom... 24 7.9 >SPAC2F7.06c |pol4||DNA polymerase X family|Schizosaccharomyces pombe|chr 1|||Manual Length = 506 Score = 26.6 bits (56), Expect = 1.5 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = +3 Query: 12 DLKYLSISHIYLSGQKLDIYTLRRGGDFC 98 DLK + SH+ LS +I L+ G D C Sbjct: 444 DLKLYANSHLGLSYDSFEIINLKTGKDIC 472 >SPAC3H8.03 |||mitochondrial ribosomal protein subunit Img2|Schizosaccharomyces pombe|chr 1|||Manual Length = 105 Score = 24.6 bits (51), Expect = 6.0 Identities = 10/33 (30%), Positives = 20/33 (60%) Frame = -2 Query: 110 MRPITKVSSSPQCIYVKLLTGQIYMRDG*ILQI 12 +R I+ + SP+ +YV LT Q+ ++ I+ + Sbjct: 64 LRLISTLKMSPKDVYVNKLTNQVVLKGNHIVTV 96 >SPAP8A3.12c |||tripeptidylpeptidase |Schizosaccharomyces pombe|chr 1|||Manual Length = 1274 Score = 24.6 bits (51), Expect = 6.0 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -2 Query: 164 PKTNEHMKNFKISRTKKFMRPIT 96 P T E +N + TKK +PIT Sbjct: 954 PSTLERFRNVTLRLTKKLKKPIT 976 >SPAC32A11.02c |||conserved fungal protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 851 Score = 24.2 bits (50), Expect = 7.9 Identities = 12/33 (36%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Frame = -1 Query: 102 NHKSLLLSSMY-ICQASDRTNIYERWIDTSDRM 7 N LL +++Y + QA TN+ E W D ++ M Sbjct: 88 NEGDLLQNAIYELSQAEGSTNVNEVWNDITEDM 120 >SPBC3F6.05 |rga1||GTPase activating protein Rga1|Schizosaccharomyces pombe|chr 2|||Manual Length = 1150 Score = 24.2 bits (50), Expect = 7.9 Identities = 15/41 (36%), Positives = 24/41 (58%), Gaps = 1/41 (2%) Frame = -2 Query: 152 EHMKNFKISRTKKFMRPITKVSSSPQCIYV-KLLTGQIYMR 33 E ++ K S T F + + KVSSS C ++++GQ Y+R Sbjct: 90 EEQQSLKRSDTSVFPKAVRKVSSSKICASCGQVISGQ-YVR 129 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,525,125 Number of Sequences: 5004 Number of extensions: 27451 Number of successful extensions: 47 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 46 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 47 length of database: 2,362,478 effective HSP length: 66 effective length of database: 2,032,214 effective search space used: 140222766 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -