SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ceN-0637
         (408 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

01_06_1317 - 36251231-36251341,36252514-36252609,36252879-362529...    27   7.6  

>01_06_1317 -
           36251231-36251341,36252514-36252609,36252879-36252956,
           36253037-36253138,36254509-36254784
          Length = 220

 Score = 26.6 bits (56), Expect = 7.6
 Identities = 10/30 (33%), Positives = 17/30 (56%)
 Frame = +3

Query: 66  IYTLRRGGDFCDWTHKFFGPGNFKIFHMFI 155
           I+ ++R    C W +   G  N+KIF +F+
Sbjct: 86  IHEIKRKDHHCIWINNCVGHENYKIFLVFV 115


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 9,340,973
Number of Sequences: 37544
Number of extensions: 162665
Number of successful extensions: 305
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 301
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 305
length of database: 14,793,348
effective HSP length: 75
effective length of database: 11,977,548
effective search space used: 718652880
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -