BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0637 (408 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ103706-1|AAZ43087.1| 344|Anopheles gambiae pk-1 receptor prot... 24 2.5 AY344837-1|AAR05808.1| 221|Anopheles gambiae TEP4 protein. 23 4.3 >DQ103706-1|AAZ43087.1| 344|Anopheles gambiae pk-1 receptor protein. Length = 344 Score = 23.8 bits (49), Expect = 2.5 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = -2 Query: 140 NFKISRTKKFMRPITKVSSSPQCIYVKLLTGQIYMRDG 27 +F++S F P+T ++ I +KL T + RDG Sbjct: 206 SFELSTFLFFFAPMTMITILYALIGLKLRTSTLMQRDG 243 >AY344837-1|AAR05808.1| 221|Anopheles gambiae TEP4 protein. Length = 221 Score = 23.0 bits (47), Expect = 4.3 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = -1 Query: 63 QASDRTNIYERWIDTSDRM 7 QAS RTN E W+ +D++ Sbjct: 115 QASFRTNFLESWLWKTDKI 133 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 385,682 Number of Sequences: 2352 Number of extensions: 7170 Number of successful extensions: 13 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 563,979 effective HSP length: 58 effective length of database: 427,563 effective search space used: 32922351 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -