BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0637 (408 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monoo... 21 4.1 DQ325124-1|ABD14138.1| 179|Apis mellifera complementary sex det... 21 5.4 DQ325123-1|ABD14137.1| 179|Apis mellifera complementary sex det... 21 5.4 DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related pro... 20 9.4 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 20 9.4 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 20 9.4 >DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monooxygenase protein. Length = 548 Score = 21.4 bits (43), Expect = 4.1 Identities = 11/24 (45%), Positives = 13/24 (54%) Frame = -2 Query: 299 NELTERTCRRISYAYVSRCYGDRS 228 N L E+T R YA+V G RS Sbjct: 464 NFLPEKTANRHYYAFVPFSAGPRS 487 >DQ325124-1|ABD14138.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.0 bits (42), Expect = 5.4 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = -1 Query: 120 QKIYASNHKSLLLSSMYICQASDRTNIY 37 +K+Y +N+K L + YI Q IY Sbjct: 97 KKLYCNNYKKLYYNINYIEQIPIPVPIY 124 >DQ325123-1|ABD14137.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.0 bits (42), Expect = 5.4 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = -1 Query: 120 QKIYASNHKSLLLSSMYICQASDRTNIY 37 +K+Y +N+K L + YI Q IY Sbjct: 97 KKLYCNNYKKLYYNINYIEQIPIPVPIY 124 >DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related protein STG-1 protein. Length = 397 Score = 20.2 bits (40), Expect = 9.4 Identities = 6/34 (17%), Positives = 18/34 (52%) Frame = -1 Query: 132 NFQDQKIYASNHKSLLLSSMYICQASDRTNIYER 31 + + ++ +NH ++L S ++C+ + + R Sbjct: 275 HLDNHHVHHANHHAILGHSGFLCERHQKRYFFGR 308 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 20.2 bits (40), Expect = 9.4 Identities = 9/19 (47%), Positives = 10/19 (52%) Frame = +3 Query: 120 GPGNFKIFHMFIGFGRCVC 176 G G FKI +F G G C Sbjct: 87 GLGVFKIAPIFKGIGYATC 105 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 20.2 bits (40), Expect = 9.4 Identities = 9/19 (47%), Positives = 10/19 (52%) Frame = +3 Query: 120 GPGNFKIFHMFIGFGRCVC 176 G G FKI +F G G C Sbjct: 140 GLGVFKIAPIFKGIGYATC 158 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 100,707 Number of Sequences: 438 Number of extensions: 2165 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 52 effective length of database: 123,567 effective search space used: 10256061 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -