BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0635 (784 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EU008544-1|ABS31131.1| 493|Tribolium castaneum cytochrome P450 ... 24 1.6 AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 22 6.4 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 22 6.4 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 22 6.4 >EU008544-1|ABS31131.1| 493|Tribolium castaneum cytochrome P450 protein. Length = 493 Score = 23.8 bits (49), Expect = 1.6 Identities = 14/41 (34%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Frame = -2 Query: 570 IFQKEYN*KFT-RNAVYNTDIDLFNFNT*FAPLELKWLNLK 451 + K+++ KFT RN N D F+T F + W NL+ Sbjct: 88 VLVKDFD-KFTNRNIATNESADPLAFHTLFISKDAVWRNLR 127 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 21.8 bits (44), Expect = 6.4 Identities = 8/23 (34%), Positives = 13/23 (56%) Frame = +2 Query: 311 ICFSLEKDKCTLSVSFKSSAYPI 379 IC++ K C + + S A+PI Sbjct: 144 ICYAFGKFSCKVMIQSVSFAFPI 166 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 21.8 bits (44), Expect = 6.4 Identities = 8/23 (34%), Positives = 13/23 (56%) Frame = +2 Query: 311 ICFSLEKDKCTLSVSFKSSAYPI 379 IC++ K C + + S A+PI Sbjct: 377 ICYAFGKFSCKVMIQSVSFAFPI 399 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 21.8 bits (44), Expect = 6.4 Identities = 8/23 (34%), Positives = 13/23 (56%) Frame = +2 Query: 311 ICFSLEKDKCTLSVSFKSSAYPI 379 IC++ K C + + S A+PI Sbjct: 377 ICYAFGKFSCKVMIQSVSFAFPI 399 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 162,124 Number of Sequences: 336 Number of extensions: 3220 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21168876 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -