BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0635 (784 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_18622| Best HMM Match : DUF229 (HMM E-Value=0.29) 29 3.2 SB_42271| Best HMM Match : DUF229 (HMM E-Value=0) 29 5.6 >SB_18622| Best HMM Match : DUF229 (HMM E-Value=0.29) Length = 307 Score = 29.5 bits (63), Expect = 3.2 Identities = 22/71 (30%), Positives = 39/71 (54%), Gaps = 2/71 (2%) Frame = +2 Query: 176 DNEHPLQLLPNYNTGFIN*FSTFRIEAKRPTDLKT*I--LSAYKKYSICFSLEKDKCTLS 349 D + +Q + + N GF ++ ++ +P+ LK I + AY K SIC +++ CT Sbjct: 234 DTLYQIQFVTSPNEGFYE--ASIKLNNGKPS-LKGEISRVDAYGKQSICARIKRVSCTRR 290 Query: 350 VSFKSSAYPIV 382 V SSA+P++ Sbjct: 291 V---SSAFPVL 298 >SB_42271| Best HMM Match : DUF229 (HMM E-Value=0) Length = 591 Score = 28.7 bits (61), Expect = 5.6 Identities = 16/47 (34%), Positives = 21/47 (44%) Frame = -2 Query: 465 WLNLKFLFFYKRQKCNRRIVTF*FFDYVTIG*ALDLKETERVHLSFS 325 W K YK K N RI+T F Y T+ + + T V LS + Sbjct: 479 WFRRKHWNMYKNLKFNSRILTSPFDIYATLKHIISIDRTATVRLSLN 525 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,283,012 Number of Sequences: 59808 Number of extensions: 338168 Number of successful extensions: 719 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 683 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 719 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2143884611 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -