Bombyx BLAST Result against arabidopsis

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ceN-0635
         (784 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At1g30600.1 68414.m03743 subtilase family protein Strong similar...    30   2.0  

>At1g30600.1 68414.m03743 subtilase family protein Strong similarity
           to gb|U80583 proteinase TMP from Lycopersicon esculentum
           and is a member of the PF|00082 subtilase family
          Length = 832

 Score = 29.9 bits (64), Expect = 2.0
 Identities = 16/50 (32%), Positives = 28/50 (56%)
 Frame = -2

Query: 360 LKETERVHLSFSRLKQIEYFL*ADRIYVFRSVGRLASILKVLNQLIKPVL 211
           LK+   VH S       ++ L A    ++R++ R ASI++V + L++ VL
Sbjct: 41  LKDRPSVHFSGRESSDSKHSLTATSSQIYRTLNRSASIIRVHDSLLRNVL 90


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 13,487,316
Number of Sequences: 28952
Number of extensions: 237711
Number of successful extensions: 490
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 484
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 490
length of database: 12,070,560
effective HSP length: 80
effective length of database: 9,754,400
effective search space used: 1755792000
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)