BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0634 (471 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_50855| Best HMM Match : Ras (HMM E-Value=0) 169 1e-42 SB_13045| Best HMM Match : Ras (HMM E-Value=0) 83 9e-17 SB_4971| Best HMM Match : Ras (HMM E-Value=0) 80 1e-15 SB_7589| Best HMM Match : Ras (HMM E-Value=0) 76 1e-14 SB_32061| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 4e-14 SB_27557| Best HMM Match : Ras (HMM E-Value=0) 75 4e-14 SB_24842| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 7e-14 SB_33745| Best HMM Match : Ras (HMM E-Value=2.5e-21) 73 2e-13 SB_3743| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 2e-12 SB_17958| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 3e-12 SB_36483| Best HMM Match : Ras (HMM E-Value=0) 67 6e-12 SB_24843| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_48712| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_58218| Best HMM Match : Ras (HMM E-Value=1.4013e-44) 64 6e-11 SB_34767| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 7e-11 SB_29253| Best HMM Match : Ras (HMM E-Value=2.8e-05) 63 1e-10 SB_28695| Best HMM Match : Ras (HMM E-Value=0) 63 1e-10 SB_22342| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 2e-10 SB_8853| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 6e-09 SB_47462| Best HMM Match : Ras (HMM E-Value=0) 55 3e-08 SB_46477| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_56256| Best HMM Match : Ras (HMM E-Value=8.9e-31) 54 6e-08 SB_41076| Best HMM Match : Ras (HMM E-Value=1.90016e-42) 54 6e-08 SB_54971| Best HMM Match : Ras (HMM E-Value=0) 50 1e-06 SB_45967| Best HMM Match : Ras (HMM E-Value=2.1e-07) 50 1e-06 SB_6223| Best HMM Match : Ras (HMM E-Value=0) 49 2e-06 SB_44625| Best HMM Match : Ras (HMM E-Value=0) 49 2e-06 SB_10811| Best HMM Match : Ras (HMM E-Value=0) 48 4e-06 SB_39864| Best HMM Match : Ras (HMM E-Value=1.6e-30) 47 7e-06 SB_52002| Best HMM Match : Ras (HMM E-Value=2.3e-19) 46 1e-05 SB_8315| Best HMM Match : Ras (HMM E-Value=0) 46 2e-05 SB_17524| Best HMM Match : Ras (HMM E-Value=2.1e-10) 46 2e-05 SB_50523| Best HMM Match : Ras (HMM E-Value=0) 45 3e-05 SB_12762| Best HMM Match : Ras (HMM E-Value=2.2e-21) 44 5e-05 SB_11757| Best HMM Match : Ras (HMM E-Value=0) 42 3e-04 SB_22528| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 5e-04 SB_39092| Best HMM Match : Arf (HMM E-Value=8e-36) 40 0.001 SB_42246| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_6284| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_24106| Best HMM Match : Ras (HMM E-Value=1e-35) 39 0.002 SB_1071| Best HMM Match : Ras (HMM E-Value=0) 39 0.002 SB_49432| Best HMM Match : Ras (HMM E-Value=1.4e-12) 38 0.003 SB_33743| Best HMM Match : Ras (HMM E-Value=2e-34) 38 0.003 SB_39585| Best HMM Match : Ras (HMM E-Value=6e-35) 38 0.004 SB_38760| Best HMM Match : Ras (HMM E-Value=4.6e-06) 38 0.006 SB_34024| Best HMM Match : VLPT (HMM E-Value=3.7) 37 0.007 SB_32162| Best HMM Match : Ras (HMM E-Value=4.7e-31) 37 0.007 SB_18358| Best HMM Match : Arf (HMM E-Value=0) 37 0.007 SB_642| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.013 SB_10598| Best HMM Match : LRR_1 (HMM E-Value=4.4e-19) 36 0.022 SB_37884| Best HMM Match : Ubie_methyltran (HMM E-Value=0.00014) 35 0.030 SB_33999| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.068 SB_45519| Best HMM Match : RNB (HMM E-Value=1.6e-35) 34 0.068 SB_53183| Best HMM Match : Ras (HMM E-Value=0) 33 0.090 SB_45581| Best HMM Match : Ras (HMM E-Value=0.069) 33 0.090 SB_31418| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.090 SB_12680| Best HMM Match : Ras (HMM E-Value=3.4e-05) 32 0.28 SB_22243| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.28 SB_42281| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.36 SB_33691| Best HMM Match : Ras (HMM E-Value=2.8e-13) 31 0.36 SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.48 SB_58700| Best HMM Match : Ras (HMM E-Value=2.7e-15) 31 0.64 SB_37042| Best HMM Match : Arf (HMM E-Value=0) 31 0.64 SB_11310| Best HMM Match : Arf (HMM E-Value=0) 31 0.64 SB_5178| Best HMM Match : Ras (HMM E-Value=9e-10) 31 0.64 SB_38579| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.84 SB_49252| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.84 SB_56255| Best HMM Match : Arf (HMM E-Value=0) 30 1.1 SB_53421| Best HMM Match : Arf (HMM E-Value=0) 30 1.1 SB_35038| Best HMM Match : Ras (HMM E-Value=6.8e-13) 30 1.1 SB_29635| Best HMM Match : E-MAP-115 (HMM E-Value=1.2) 30 1.1 SB_59261| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.5 SB_56941| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.9 SB_31919| Best HMM Match : ArgK (HMM E-Value=7.6e-15) 29 1.9 SB_44360| Best HMM Match : Ion_trans (HMM E-Value=1.99993e-41) 29 1.9 SB_39378| Best HMM Match : VWA (HMM E-Value=0) 29 1.9 SB_7861| Best HMM Match : MMR_HSR1 (HMM E-Value=0.96) 29 1.9 SB_17523| Best HMM Match : MMR_HSR1 (HMM E-Value=4.2) 29 2.6 SB_52502| Best HMM Match : GTP_CDC (HMM E-Value=1.9e-06) 28 3.4 SB_8803| Best HMM Match : Ras (HMM E-Value=7.9e-30) 28 3.4 SB_15207| Best HMM Match : Arf (HMM E-Value=1.9e-05) 28 4.5 SB_43575| Best HMM Match : Sina (HMM E-Value=0) 28 4.5 SB_32192| Best HMM Match : Guanylin (HMM E-Value=4.9) 28 4.5 SB_52469| Best HMM Match : MSSP (HMM E-Value=0.54) 27 5.9 SB_31699| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.9 SB_20852| Best HMM Match : PC_rep (HMM E-Value=1.8e-13) 27 5.9 SB_57342| Best HMM Match : Arf (HMM E-Value=0) 27 5.9 SB_54000| Best HMM Match : MMR_HSR1 (HMM E-Value=1.8) 27 5.9 SB_37124| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.9 SB_31930| Best HMM Match : RVT_1 (HMM E-Value=1.3e-33) 27 5.9 SB_1645| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.9 SB_56373| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.8 SB_52511| Best HMM Match : RVT_1 (HMM E-Value=0.00044) 27 7.8 SB_1242| Best HMM Match : DUF590 (HMM E-Value=4.2e-05) 27 7.8 >SB_50855| Best HMM Match : Ras (HMM E-Value=0) Length = 733 Score = 169 bits (410), Expect = 1e-42 Identities = 81/95 (85%), Positives = 83/95 (87%) Frame = +1 Query: 184 MATNRTGAAQRPNGAPQTKVCQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAVFL 363 MA NR G AQRPNGA K+CQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGA FL Sbjct: 1 MAANR-GGAQRPNGATMGKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFL 59 Query: 364 TPAIRFDHTTVKFEIWDTAGQERYHSLAPMYYRGA 468 T + D TTVKFEIWDTAGQERYHSLAPMYYRGA Sbjct: 60 TQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGA 94 >SB_13045| Best HMM Match : Ras (HMM E-Value=0) Length = 629 Score = 83.4 bits (197), Expect = 9e-17 Identities = 36/73 (49%), Positives = 52/73 (71%) Frame = +1 Query: 250 FKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAVFLTPAIRFDHTTVKFEIWDTAGQE 429 +K+VL+G+S VGKSSL+ RF + +F +STIG F T +I+ + +K ++WDTAGQE Sbjct: 13 YKIVLIGDSGVGKSSLLSRFTRNEFDIESKSTIGVEFATRSIQVEGKIIKAQVWDTAGQE 72 Query: 430 RYHSLAPMYYRGA 468 RY ++ YYRGA Sbjct: 73 RYRAITSAYYRGA 85 >SB_4971| Best HMM Match : Ras (HMM E-Value=0) Length = 209 Score = 79.8 bits (188), Expect = 1e-15 Identities = 38/73 (52%), Positives = 47/73 (64%) Frame = +1 Query: 250 FKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAVFLTPAIRFDHTTVKFEIWDTAGQE 429 FKL+L+G+S VGKSSL+LRF F STIG F + D T+K +IWDTAGQE Sbjct: 9 FKLLLIGDSGVGKSSLLLRFADDTFSNTYISTIGVDFKIRTLTVDGKTIKLQIWDTAGQE 68 Query: 430 RYHSLAPMYYRGA 468 R+ +L YYR A Sbjct: 69 RFRTLTTAYYRSA 81 >SB_7589| Best HMM Match : Ras (HMM E-Value=0) Length = 640 Score = 76.2 bits (179), Expect = 1e-14 Identities = 34/73 (46%), Positives = 47/73 (64%) Frame = +1 Query: 250 FKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAVFLTPAIRFDHTTVKFEIWDTAGQE 429 FK+VL G++AVGKSS +LR + +FH ST+G F + D T ++WDTAGQE Sbjct: 443 FKIVLAGDAAVGKSSFILRLCRNRFHSALNSTLGVDFQMKTLVVDGKTYALQLWDTAGQE 502 Query: 430 RYHSLAPMYYRGA 468 R+ S+A Y+R A Sbjct: 503 RFRSIAKSYFRKA 515 >SB_32061| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 919 Score = 74.5 bits (175), Expect = 4e-14 Identities = 35/72 (48%), Positives = 45/72 (62%) Frame = +1 Query: 253 KLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAVFLTPAIRFDHTTVKFEIWDTAGQER 432 K++++GES VGKSSL+LRF F +TIG F + + K IWDTAGQER Sbjct: 10 KILIVGESGVGKSSLLLRFTDDTFDPDIGATIGVDFKVKTLTVEGNKAKLAIWDTAGQER 69 Query: 433 YHSLAPMYYRGA 468 + +L P YYRGA Sbjct: 70 FRTLTPSYYRGA 81 >SB_27557| Best HMM Match : Ras (HMM E-Value=0) Length = 184 Score = 74.5 bits (175), Expect = 4e-14 Identities = 33/73 (45%), Positives = 48/73 (65%), Gaps = 1/73 (1%) Frame = +1 Query: 247 QFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAVFLTPAIRF-DHTTVKFEIWDTAG 423 QF+++L+G+S VGKSSL+ +F +GQF E + T+G F + +K +IWDTAG Sbjct: 13 QFRIILIGDSTVGKSSLLRQFTEGQFFENSDPTVGVDFHVRVLELKGDVRIKLQIWDTAG 72 Query: 424 QERYHSLAPMYYR 462 QER+ S+ YYR Sbjct: 73 QERFRSITYSYYR 85 >SB_24842| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 73.7 bits (173), Expect = 7e-14 Identities = 34/73 (46%), Positives = 45/73 (61%) Frame = +1 Query: 250 FKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAVFLTPAIRFDHTTVKFEIWDTAGQE 429 FK++L+G++ VGK+ LV +F KG F Q TIG F + D VK +IWDTAGQE Sbjct: 8 FKIILVGDANVGKTCLVRQFTKGYFPPNQGPTIGVDFTIKTVDVDGEKVKLQIWDTAGQE 67 Query: 430 RYHSLAPMYYRGA 468 R+ S+ YY A Sbjct: 68 RFRSITQSYYHNA 80 >SB_33745| Best HMM Match : Ras (HMM E-Value=2.5e-21) Length = 115 Score = 72.5 bits (170), Expect = 2e-13 Identities = 35/83 (42%), Positives = 48/83 (57%) Frame = +1 Query: 220 NGAPQTKVCQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAVFLTPAIRFDHTTVK 399 + A Q FKL+++G SAVGK+S + R+ F ST+G F + + VK Sbjct: 12 DAADQNFDYMFKLLIIGNSAVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTVFRNDKRVK 71 Query: 400 FEIWDTAGQERYHSLAPMYYRGA 468 +IWDTAGQERY ++ YYRGA Sbjct: 72 LQIWDTAGQERYRTITTAYYRGA 94 >SB_3743| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 365 Score = 68.9 bits (161), Expect = 2e-12 Identities = 33/70 (47%), Positives = 42/70 (60%) Frame = +1 Query: 253 KLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAVFLTPAIRFDHTTVKFEIWDTAGQER 432 K+V LG+ VGKSSL RF+ F E + TIG F+T + D V+ +IWDTAGQER Sbjct: 165 KIVFLGDQGVGKSSLAGRFIYDIFEEKYQPTIGIDFMTKTVLLDDFEVRLQIWDTAGQER 224 Query: 433 YHSLAPMYYR 462 + L Y R Sbjct: 225 FRCLIHSYIR 234 >SB_17958| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 271 Score = 68.1 bits (159), Expect = 3e-12 Identities = 30/73 (41%), Positives = 44/73 (60%) Frame = +1 Query: 250 FKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAVFLTPAIRFDHTTVKFEIWDTAGQE 429 FK++++G+ VGK+SL+ RF KG F + ST+G T + VK + WDTAGQE Sbjct: 12 FKVLVVGDPGVGKTSLIRRFTKGYFCDNSSSTVGVDVGTRVLDIHGDRVKLQCWDTAGQE 71 Query: 430 RYHSLAPMYYRGA 468 ++ + YYR A Sbjct: 72 KFRGITQSYYRNA 84 >SB_36483| Best HMM Match : Ras (HMM E-Value=0) Length = 213 Score = 67.3 bits (157), Expect = 6e-12 Identities = 31/73 (42%), Positives = 47/73 (64%) Frame = +1 Query: 250 FKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAVFLTPAIRFDHTTVKFEIWDTAGQE 429 FK+++LG+ VGKSSL+ RF +F+ +TIG F D VK ++WDTAG+E Sbjct: 11 FKVLVLGDCNVGKSSLIRRFHDDEFNAQLCTTIGVDFFIHDFDLDGKKVKLQLWDTAGEE 70 Query: 430 RYHSLAPMYYRGA 468 +Y +L+ ++RGA Sbjct: 71 KYRALSRSFFRGA 83 >SB_24843| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 265 Score = 66.5 bits (155), Expect = 1e-11 Identities = 31/72 (43%), Positives = 46/72 (63%), Gaps = 1/72 (1%) Frame = +1 Query: 250 FKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAVFLTPAIRFDHTTVKFEIWDTAGQE 429 FK++++G+S VGK+ L R G+F E E+TIG F ++ + VK ++WDTAGQE Sbjct: 47 FKIIIIGDSNVGKTCLAYRLCTGKFPERTETTIGVDFWEKSLELNGEFVKLQLWDTAGQE 106 Query: 430 RYH-SLAPMYYR 462 R+ S+ YYR Sbjct: 107 RFRKSMVCHYYR 118 >SB_48712| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 410 Score = 66.5 bits (155), Expect = 1e-11 Identities = 32/69 (46%), Positives = 42/69 (60%) Frame = +1 Query: 262 LLGESAVGKSSLVLRFVKGQFHEYQESTIGAVFLTPAIRFDHTTVKFEIWDTAGQERYHS 441 L + VGKSSL+ RFV G+F TIG FL ++ D + +IWDTAGQER+ S Sbjct: 216 LSSDGGVGKSSLMNRFVCGKFDTQSFHTIGVEFLNKDVKLDGESYTLQIWDTAGQERFKS 275 Query: 442 LAPMYYRGA 468 L +YRG+ Sbjct: 276 LRTPFYRGS 284 >SB_58218| Best HMM Match : Ras (HMM E-Value=1.4013e-44) Length = 212 Score = 64.1 bits (149), Expect = 6e-11 Identities = 30/73 (41%), Positives = 43/73 (58%) Frame = +1 Query: 250 FKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAVFLTPAIRFDHTTVKFEIWDTAGQE 429 FK+VLLGE+ VGK+SL R + F + +TIG + ++ V +WDTAG E Sbjct: 12 FKVVLLGEAGVGKTSLFYRLKENHFTPGRRNTIGIDSCSKFVKIGEKQVTLSVWDTAGVE 71 Query: 430 RYHSLAPMYYRGA 468 R+ ++ YYRGA Sbjct: 72 RFRTVTKNYYRGA 84 >SB_34767| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 216 Score = 63.7 bits (148), Expect = 7e-11 Identities = 29/74 (39%), Positives = 47/74 (63%), Gaps = 1/74 (1%) Frame = +1 Query: 250 FKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAVFLTPAIRF-DHTTVKFEIWDTAGQ 426 FK++++G+ GK S V R+V +H + TIG F I++ +TT++ +IW AGQ Sbjct: 19 FKVLVVGDILTGKQSFVKRYVNNIWHPLYKPTIGVDFALKTIQWAQNTTIRLQIWLIAGQ 78 Query: 427 ERYHSLAPMYYRGA 468 ER+ S+ +YY+GA Sbjct: 79 ERFSSMTRVYYKGA 92 >SB_29253| Best HMM Match : Ras (HMM E-Value=2.8e-05) Length = 68 Score = 63.3 bits (147), Expect = 1e-10 Identities = 28/56 (50%), Positives = 41/56 (73%) Frame = +1 Query: 250 FKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAVFLTPAIRFDHTTVKFEIWDT 417 FK+VL+G+S VGKS+L+ RF + +F+ +STIG F T +I+ D T+K +IWDT Sbjct: 12 FKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDT 67 >SB_28695| Best HMM Match : Ras (HMM E-Value=0) Length = 1058 Score = 63.3 bits (147), Expect = 1e-10 Identities = 29/73 (39%), Positives = 43/73 (58%) Frame = +1 Query: 250 FKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAVFLTPAIRFDHTTVKFEIWDTAGQE 429 FK+V +G+S VGKSS + RF Q+ +TIG F + + + ++WDTAGQE Sbjct: 897 FKVVFIGDSGVGKSSFLHRFCHDQWKPSFTATIGVDFQIKTMNVNGQCIAIQLWDTAGQE 956 Query: 430 RYHSLAPMYYRGA 468 R+ S+ Y+R A Sbjct: 957 RFRSITKQYFRKA 969 >SB_22342| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 778 Score = 62.5 bits (145), Expect = 2e-10 Identities = 40/94 (42%), Positives = 50/94 (53%), Gaps = 21/94 (22%) Frame = +1 Query: 250 FKLVLLGESAVGKSSLVLRF------------------VKGQFHEYQES---TIGAVFLT 366 FKL+L+G+S VGKS L+LRF + Q Y ES TIG F Sbjct: 9 FKLLLIGDSGVGKSCLLLRFALSLAQKLLLFRIYSHPTLSQQDDTYTESYISTIGVDFKI 68 Query: 367 PAIRFDHTTVKFEIWDTAGQERYHSLAPMYYRGA 468 I D T+K +IWDTAGQER+ ++ YYRGA Sbjct: 69 RTIELDGKTIKLQIWDTAGQERFRTITSSYYRGA 102 >SB_8853| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 57.2 bits (132), Expect = 6e-09 Identities = 25/57 (43%), Positives = 38/57 (66%) Frame = +1 Query: 250 FKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAVFLTPAIRFDHTTVKFEIWDTA 420 FK+VL+G+S VGKS+L+ R+ K +FH ++TIG + + TV+ +IWDTA Sbjct: 19 FKIVLIGDSGVGKSNLLSRYTKNEFHLGSKATIGVELAHRNVEIEGKTVRAQIWDTA 75 >SB_47462| Best HMM Match : Ras (HMM E-Value=0) Length = 385 Score = 54.8 bits (126), Expect = 3e-08 Identities = 29/72 (40%), Positives = 43/72 (59%) Frame = +1 Query: 247 QFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAVFLTPAIRFDHTTVKFEIWDTAGQ 426 ++K+V+LG VGKS+L ++FV GQF E + TI F I D+ EI DTAG Sbjct: 3 EYKVVVLGSGGVGKSALTVQFVTGQFVEKYDPTI-EDFYRKEIEVDNNPSILEILDTAGT 61 Query: 427 ERYHSLAPMYYR 462 E++ S+ +Y + Sbjct: 62 EQFASMRDLYIK 73 >SB_46477| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 6116 Score = 54.4 bits (125), Expect = 5e-08 Identities = 28/69 (40%), Positives = 40/69 (57%) Frame = +1 Query: 253 KLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAVFLTPAIRFDHTTVKFEIWDTAGQER 432 KLV++G+ A GK+ L++ F K QF E T+ ++ I D V+ +WDTAGQE Sbjct: 5931 KLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVAD-IEVDGKQVELALWDTAGQED 5989 Query: 433 YHSLAPMYY 459 Y L P+ Y Sbjct: 5990 YDRLRPLSY 5998 >SB_56256| Best HMM Match : Ras (HMM E-Value=8.9e-31) Length = 506 Score = 54.0 bits (124), Expect = 6e-08 Identities = 28/82 (34%), Positives = 50/82 (60%) Frame = +1 Query: 214 RPNGAPQTKVCQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAVFLTPAIRFDHTT 393 RPNG Q ++ ++L+G+S GK++L+ +V+ QF+E E+T+ L+ A+ D Sbjct: 226 RPNG--QIRI---PVILVGDSECGKTALLNAYVRNQFNEKYEATV-FNSLSTAVEVDGER 279 Query: 394 VKFEIWDTAGQERYHSLAPMYY 459 ++ +WDT+G E Y + P+ Y Sbjct: 280 IELTLWDTSGHEDYDHVRPLSY 301 >SB_41076| Best HMM Match : Ras (HMM E-Value=1.90016e-42) Length = 704 Score = 54.0 bits (124), Expect = 6e-08 Identities = 29/75 (38%), Positives = 42/75 (56%), Gaps = 2/75 (2%) Frame = +1 Query: 247 QFKLVLLGESAVGKSSLVLRFVKGQFH-EYQESTIGAV-FLTPAIRFDHTTVKFEIWDTA 420 +FK +++G S VGKS LV + F ++ ST+ +D+ +K I DTA Sbjct: 350 EFKTLIIGNSGVGKSCLVNKLKNPHFDLKFVTSTVSMNDIFWEYFLYDNKKIKLTIGDTA 409 Query: 421 GQERYHSLAPMYYRG 465 GQERY S+ P Y+RG Sbjct: 410 GQERYFSILPAYFRG 424 >SB_54971| Best HMM Match : Ras (HMM E-Value=0) Length = 239 Score = 50.0 bits (114), Expect = 1e-06 Identities = 25/66 (37%), Positives = 39/66 (59%), Gaps = 1/66 (1%) Frame = +1 Query: 265 LGESAVGKSSLVLRFVKGQFHEYQESTIGAVFLTPAIRF-DHTTVKFEIWDTAGQERYHS 441 +G+ GK++ V R + G+F + +T+G V + P I F +KF +WDTAGQE++ Sbjct: 38 VGDGGTGKTTFVKRHLTGEFEKKYIATLG-VEVHPLIFFTSRGPIKFNVWDTAGQEKFGG 96 Query: 442 LAPMYY 459 L YY Sbjct: 97 LRDGYY 102 >SB_45967| Best HMM Match : Ras (HMM E-Value=2.1e-07) Length = 92 Score = 50.0 bits (114), Expect = 1e-06 Identities = 28/69 (40%), Positives = 42/69 (60%) Frame = +1 Query: 253 KLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAVFLTPAIRFDHTTVKFEIWDTAGQER 432 K+ ++G +VGKSSL ++FV+GQF + + TI F T I++ E+ DTAGQ+ Sbjct: 8 KIAVMGFRSVGKSSLTIQFVEGQFVDSYDPTIENTF-TKNIKYKGQEFFLELVDTAGQDE 66 Query: 433 YHSLAPMYY 459 Y S+ P Y Sbjct: 67 Y-SIFPQSY 74 >SB_6223| Best HMM Match : Ras (HMM E-Value=0) Length = 1665 Score = 48.8 bits (111), Expect = 2e-06 Identities = 24/72 (33%), Positives = 39/72 (54%) Frame = +1 Query: 247 QFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAVFLTPAIRFDHTTVKFEIWDTAGQ 426 Q+KLV++G VGKS+L ++F++ F + TI + + D +I DTAGQ Sbjct: 11 QYKLVVVGGGGVGKSALTIQFIQSHFVSDYDPTIEDSYRKQCV-IDERVAHLDILDTAGQ 69 Query: 427 ERYHSLAPMYYR 462 E + ++ Y R Sbjct: 70 EEFSAMREQYMR 81 >SB_44625| Best HMM Match : Ras (HMM E-Value=0) Length = 128 Score = 48.8 bits (111), Expect = 2e-06 Identities = 21/42 (50%), Positives = 26/42 (61%) Frame = +1 Query: 340 STIGAVFLTPAIRFDHTTVKFEIWDTAGQERYHSLAPMYYRG 465 +TIG F I D VK +IWDTAGQER+ ++ YYRG Sbjct: 8 TTIGVDFKIRTINIDGEKVKLQIWDTAGQERFRTITSTYYRG 49 >SB_10811| Best HMM Match : Ras (HMM E-Value=0) Length = 304 Score = 48.0 bits (109), Expect = 4e-06 Identities = 21/42 (50%), Positives = 27/42 (64%) Frame = +1 Query: 343 TIGAVFLTPAIRFDHTTVKFEIWDTAGQERYHSLAPMYYRGA 468 TIG F + + +VK +IWDTAGQER+ S+ YYRGA Sbjct: 127 TIGVEFGSKIVNVGGKSVKLQIWDTAGQERFRSVTRSYYRGA 168 >SB_39864| Best HMM Match : Ras (HMM E-Value=1.6e-30) Length = 421 Score = 47.2 bits (107), Expect = 7e-06 Identities = 19/24 (79%), Positives = 21/24 (87%) Frame = +1 Query: 397 KFEIWDTAGQERYHSLAPMYYRGA 468 KF IWDTAGQER+ SLAP+YYR A Sbjct: 10 KFNIWDTAGQERFKSLAPLYYRDA 33 >SB_52002| Best HMM Match : Ras (HMM E-Value=2.3e-19) Length = 351 Score = 46.4 bits (105), Expect = 1e-05 Identities = 24/73 (32%), Positives = 37/73 (50%) Frame = +1 Query: 250 FKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAVFLTPAIRFDHTTVKFEIWDTAGQE 429 F++V+LG VGK+SLV RF+ G F E T+G ++ EI DTAG Sbjct: 108 FRVVVLGSGGVGKTSLVKRFISGTFSEQYTPTVGDLYEKSVTLSKDFNAFLEIMDTAGSY 167 Query: 430 RYHSLAPMYYRGA 468 + ++ + + A Sbjct: 168 PFPAMKKLTIQNA 180 >SB_8315| Best HMM Match : Ras (HMM E-Value=0) Length = 565 Score = 45.6 bits (103), Expect = 2e-05 Identities = 29/90 (32%), Positives = 45/90 (50%), Gaps = 11/90 (12%) Frame = +1 Query: 232 QTKVCQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAVFLTPAIRF-------DHT 390 Q K K + LG+S VGK+SL+ ++ F+ TIG F + + + Sbjct: 101 QGKEFLIKFLALGDSGVGKTSLLYQYTDSHFNPRFVPTIGIDFREKRVVHHPLNPDGERS 160 Query: 391 T----VKFEIWDTAGQERYHSLAPMYYRGA 468 T + ++WDTAGQER+ SL ++R A Sbjct: 161 TRGQRIHLQLWDTAGQERFRSLTTAFFRDA 190 >SB_17524| Best HMM Match : Ras (HMM E-Value=2.1e-10) Length = 159 Score = 45.6 bits (103), Expect = 2e-05 Identities = 24/72 (33%), Positives = 38/72 (52%), Gaps = 2/72 (2%) Frame = +1 Query: 250 FKLVLLGESAVGKSSLVLRFVKGQFHEYQEST--IGAVFLTPAIRFDHTTVKFEIWDTAG 423 +K+ L G+ VGK+S+ R +F E ++S I F+ P + + +K +WDT G Sbjct: 9 YKIALCGKMGVGKTSIYTRLSTDEFPEEEQSLHHIDQCFI-PLVCICNKKLKIHLWDTLG 67 Query: 424 QERYHSLAPMYY 459 E Y SL +Y Sbjct: 68 MEEYESLTRNHY 79 >SB_50523| Best HMM Match : Ras (HMM E-Value=0) Length = 154 Score = 45.2 bits (102), Expect = 3e-05 Identities = 16/25 (64%), Positives = 21/25 (84%) Frame = +1 Query: 394 VKFEIWDTAGQERYHSLAPMYYRGA 468 +K +IWDTAGQER+H++ YYRGA Sbjct: 5 IKLQIWDTAGQERFHTITTAYYRGA 29 >SB_12762| Best HMM Match : Ras (HMM E-Value=2.2e-21) Length = 242 Score = 44.4 bits (100), Expect = 5e-05 Identities = 23/71 (32%), Positives = 43/71 (60%) Frame = +1 Query: 232 QTKVCQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAVFLTPAIRFDHTTVKFEIW 411 +T + +F +V G S+VGK+SL+LRF+ F++ TI F+ + F++ T + +I Sbjct: 23 ETSLRRFTIVFFGASSVGKTSLILRFLGYAFNDDYSPTIEDFFI-KHVFFNNETYELQII 81 Query: 412 DTAGQERYHSL 444 DT+G + ++ Sbjct: 82 DTSGTYEFPAM 92 >SB_11757| Best HMM Match : Ras (HMM E-Value=0) Length = 211 Score = 41.5 bits (93), Expect = 3e-04 Identities = 23/75 (30%), Positives = 39/75 (52%), Gaps = 1/75 (1%) Frame = +1 Query: 247 QFKLVLLGESAVGKSSLVLRFVKGQF-HEYQESTIGAVFLTPAIRFDHTTVKFEIWDTAG 423 Q K V++G+ VGK+SL++ ++ F + Y + +T + + E DTAG Sbjct: 18 QLKCVIVGDGGVGKTSLLVSYMMDGFPNSYVPTAFDTYHVT--VEVNKKLCMIEFCDTAG 75 Query: 424 QERYHSLAPMYYRGA 468 QE + +L P+ Y A Sbjct: 76 QEDFDALRPLCYSSA 90 >SB_22528| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 467 Score = 41.1 bits (92), Expect = 5e-04 Identities = 23/69 (33%), Positives = 34/69 (49%) Frame = +1 Query: 253 KLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAVFLTPAIRFDHTTVKFEIWDTAGQER 432 KLV++G+ VGKS+ ++ F T+ + + I D +WDTAGQE Sbjct: 7 KLVVVGDGGVGKSAFLITATTNAFPGEYIPTVFDNY-SSNIMLDGKAYNVGLWDTAGQED 65 Query: 433 YHSLAPMYY 459 Y L P+ Y Sbjct: 66 YDRLRPLSY 74 >SB_39092| Best HMM Match : Arf (HMM E-Value=8e-36) Length = 260 Score = 39.9 bits (89), Expect = 0.001 Identities = 24/73 (32%), Positives = 36/73 (49%) Frame = +1 Query: 247 QFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAVFLTPAIRFDHTTVKFEIWDTAGQ 426 + +L L+G GK++ V GQF E T+G F + + T+K +WD GQ Sbjct: 20 EMELTLVGLQYSGKTTFVNVIASGQFSEDMIPTVG--FNMRKVSKGNVTIK--VWDIGGQ 75 Query: 427 ERYHSLAPMYYRG 465 R+ S+ Y RG Sbjct: 76 PRFRSMWERYCRG 88 >SB_42246| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 310 Score = 39.9 bits (89), Expect = 0.001 Identities = 24/58 (41%), Positives = 34/58 (58%), Gaps = 1/58 (1%) Frame = +1 Query: 250 FKLVLLGESAVGKSSLVLRFVKGQF-HEYQESTIGAVFLTPAIRFDHTTVKFEIWDTA 420 + LVLLG++ VGKS+L++RF G+F HEY + T+ + A D I DTA Sbjct: 128 YSLVLLGQAGVGKSALLVRFCTGRFIHEY-DPTLEMTYDVSA-TIDEDPATLHITDTA 183 >SB_6284| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 39.9 bits (89), Expect = 0.001 Identities = 24/70 (34%), Positives = 39/70 (55%), Gaps = 1/70 (1%) Frame = +1 Query: 253 KLVLLGESAVGKSSLVLRFVKGQF-HEYQESTIGAVFLTPAIRFDHTTVKFEIWDTAGQE 429 K V++G+ AVGK+ L++ + +F EY + +T I + T+ ++DTAGQE Sbjct: 5 KCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLG--LFDTAGQE 62 Query: 430 RYHSLAPMYY 459 Y L P+ Y Sbjct: 63 DYDRLRPLSY 72 >SB_24106| Best HMM Match : Ras (HMM E-Value=1e-35) Length = 263 Score = 39.1 bits (87), Expect = 0.002 Identities = 21/59 (35%), Positives = 35/59 (59%) Frame = +1 Query: 250 FKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAVFLTPAIRFDHTTVKFEIWDTAGQ 426 +++ LLG+ VGK++L++RF+ +F + TI + +I D TV EI DTA + Sbjct: 6 YRIALLGDEGVGKTALLVRFLCHRFLGEYDPTIEDKY-RKSINIDDVTVTLEILDTASR 63 >SB_1071| Best HMM Match : Ras (HMM E-Value=0) Length = 228 Score = 39.1 bits (87), Expect = 0.002 Identities = 17/34 (50%), Positives = 25/34 (73%) Frame = +1 Query: 247 QFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTI 348 ++K+V+LG VGKS+L ++FV GQF E + TI Sbjct: 3 EYKVVVLGSGGVGKSALTVQFVTGQFVEKYDPTI 36 >SB_49432| Best HMM Match : Ras (HMM E-Value=1.4e-12) Length = 460 Score = 38.3 bits (85), Expect = 0.003 Identities = 20/60 (33%), Positives = 36/60 (60%) Frame = +1 Query: 253 KLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAVFLTPAIRFDHTTVKFEIWDTAGQER 432 ++V+LG+ VGKS+L +RF+ +F + T+ + ++ D+ V +I DTAG+ R Sbjct: 18 RVVVLGKDGVGKSALTVRFLTRRFIGEYDQTLESTH-RHILQIDNEDVSLDISDTAGEVR 76 >SB_33743| Best HMM Match : Ras (HMM E-Value=2e-34) Length = 241 Score = 38.3 bits (85), Expect = 0.003 Identities = 14/23 (60%), Positives = 18/23 (78%) Frame = +1 Query: 394 VKFEIWDTAGQERYHSLAPMYYR 462 VK +IWDTAGQER+ ++ YYR Sbjct: 95 VKLQIWDTAGQERFRTITQSYYR 117 >SB_39585| Best HMM Match : Ras (HMM E-Value=6e-35) Length = 145 Score = 37.9 bits (84), Expect = 0.004 Identities = 15/21 (71%), Positives = 17/21 (80%) Frame = +1 Query: 406 IWDTAGQERYHSLAPMYYRGA 468 IWDTAGQER+ SL +YRGA Sbjct: 1 IWDTAGQERFQSLGVAFYRGA 21 >SB_38760| Best HMM Match : Ras (HMM E-Value=4.6e-06) Length = 965 Score = 37.5 bits (83), Expect = 0.006 Identities = 20/58 (34%), Positives = 33/58 (56%) Frame = +1 Query: 253 KLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAVFLTPAIRFDHTTVKFEIWDTAGQ 426 K+V++GE VGKS+L +RF+ +F + T+ + + A V E+ DTAG+ Sbjct: 863 KVVIIGEDGVGKSALTVRFLTKRFIGEYDDTLESTYRQDA-EVAGEVVAIELTDTAGE 919 >SB_34024| Best HMM Match : VLPT (HMM E-Value=3.7) Length = 368 Score = 37.1 bits (82), Expect = 0.007 Identities = 15/35 (42%), Positives = 26/35 (74%) Frame = +1 Query: 247 QFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIG 351 ++ +V+LG + VGK++LV+RFV G+F + T+G Sbjct: 324 KYSMVVLGAAGVGKTALVVRFVTGRFLNEYDPTLG 358 >SB_32162| Best HMM Match : Ras (HMM E-Value=4.7e-31) Length = 357 Score = 37.1 bits (82), Expect = 0.007 Identities = 23/76 (30%), Positives = 40/76 (52%), Gaps = 2/76 (2%) Frame = +1 Query: 247 QFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAVFLTPAIRFDHTTVKF--EIWDTA 420 + K+VL G++ VGK+S ++ + + E T A F + + + KF ++WDT Sbjct: 6 KLKVVLTGDNNVGKTSFLINLTQNEL----EGTPTA-FANYELGLEVGSQKFLLDLWDTE 60 Query: 421 GQERYHSLAPMYYRGA 468 G Y L P+ Y+G+ Sbjct: 61 GTTEYDRLRPLTYQGS 76 >SB_18358| Best HMM Match : Arf (HMM E-Value=0) Length = 214 Score = 37.1 bits (82), Expect = 0.007 Identities = 22/71 (30%), Positives = 35/71 (49%) Frame = +1 Query: 250 FKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAVFLTPAIRFDHTTVKFEIWDTAGQE 429 F +V+LG GK+S++ R +F EY + F IR ++F++WD G+E Sbjct: 22 FHVVMLGLDKSGKTSILYR---NKFREYVNTVPTTAFNVETIR-PFKGIRFKVWDIGGRE 77 Query: 430 RYHSLAPMYYR 462 + L Y R Sbjct: 78 QNRPLWKAYAR 88 >SB_642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2229 Score = 36.3 bits (80), Expect = 0.013 Identities = 21/65 (32%), Positives = 34/65 (52%), Gaps = 2/65 (3%) Frame = +1 Query: 253 KLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAVFLTPAIRFD--HTTVKFEIWDTAGQ 426 KL+L+G A GK++L+ R + + +T G ++ D H F+IWD GQ Sbjct: 553 KLMLVGREAQGKTTLMHRLMLDNTYFINSATNGISMEEFRLKKDFLHREFIFKIWDFGGQ 612 Query: 427 ERYHS 441 E Y++ Sbjct: 613 EDYYA 617 >SB_10598| Best HMM Match : LRR_1 (HMM E-Value=4.4e-19) Length = 811 Score = 35.5 bits (78), Expect = 0.022 Identities = 24/72 (33%), Positives = 34/72 (47%), Gaps = 2/72 (2%) Frame = +1 Query: 247 QFKLVLLGESAVGKSSLVLRFVKGQF--HEYQESTIGAVFLTPAIRFDHTTVKFEIWDTA 420 + KLVLLGES GK+S V+ + + T+G V + D V ++ D A Sbjct: 260 RIKLVLLGESGAGKTSCAHGLVECEAINQTLNDGTVGVVIRNWQVEPDGLEV--QVVDCA 317 Query: 421 GQERYHSLAPMY 456 GQ RY P + Sbjct: 318 GQRRYQLTHPFF 329 >SB_37884| Best HMM Match : Ubie_methyltran (HMM E-Value=0.00014) Length = 399 Score = 35.1 bits (77), Expect = 0.030 Identities = 14/32 (43%), Positives = 21/32 (65%) Frame = -2 Query: 347 MVLSWYSWNCPLTNRSTSEDLPTADSPNNTSL 252 +V S++S NCP+TN + D PT P+ T+L Sbjct: 4 IVGSYFSTNCPVTNCKVNADFPTPPDPSTTTL 35 >SB_33999| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 33.9 bits (74), Expect = 0.068 Identities = 14/34 (41%), Positives = 23/34 (67%) Frame = +1 Query: 250 FKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIG 351 FK++++G++ VGK+S V R+V G + TIG Sbjct: 23 FKVLIVGDATVGKTSFVQRYVHGNTRREYKPTIG 56 >SB_45519| Best HMM Match : RNB (HMM E-Value=1.6e-35) Length = 2748 Score = 33.9 bits (74), Expect = 0.068 Identities = 22/64 (34%), Positives = 32/64 (50%) Frame = +1 Query: 250 FKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAVFLTPAIRFDHTTVKFEIWDTAGQE 429 F+L ++G VGKSS+ +R++K +F E I + E+ DTAGQE Sbjct: 2599 FRLCVVGSGGVGKSSVTIRYLKNEFTE--------------IDYCGKLYDIEVVDTAGQE 2644 Query: 430 RYHS 441 Y S Sbjct: 2645 EYTS 2648 >SB_53183| Best HMM Match : Ras (HMM E-Value=0) Length = 834 Score = 33.5 bits (73), Expect = 0.090 Identities = 17/38 (44%), Positives = 24/38 (63%) Frame = +1 Query: 250 FKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAVFL 363 FKL+L+G+S VGK+ ++ RF F+ STI V L Sbjct: 10 FKLLLIGDSGVGKTCILFRFSDDAFNTTFISTIENVLL 47 >SB_45581| Best HMM Match : Ras (HMM E-Value=0.069) Length = 284 Score = 33.5 bits (73), Expect = 0.090 Identities = 15/41 (36%), Positives = 25/41 (60%) Frame = +1 Query: 229 PQTKVCQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIG 351 P V ++V+LG+ VGKS+L +R + +F +ST+G Sbjct: 10 PNDNVRSLRVVVLGQDGVGKSALTVRLLTKRFIGEYDSTLG 50 >SB_31418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 359 Score = 33.5 bits (73), Expect = 0.090 Identities = 20/51 (39%), Positives = 27/51 (52%), Gaps = 1/51 (1%) Frame = -2 Query: 335 WYSWNCPLTN-RSTSEDLPTADSPNNTSLNWQTFVCGAPLGLCAAPVLFVA 186 W S+ C L R+ +ED P AD+ S Q+F C P+G C V+ VA Sbjct: 36 WSSFTCVLEEVRNPTED-PVADNQELNSFVPQSFTCADPVGFCWWIVVKVA 85 >SB_12680| Best HMM Match : Ras (HMM E-Value=3.4e-05) Length = 243 Score = 31.9 bits (69), Expect = 0.28 Identities = 18/50 (36%), Positives = 24/50 (48%), Gaps = 6/50 (12%) Frame = +1 Query: 331 YQESTIGAVFLTPAIRFDHT------TVKFEIWDTAGQERYHSLAPMYYR 462 YQ+ TIG F I + T TVK + WD A ER+ + +Y R Sbjct: 81 YQKPTIGVDFYVHFIEWRETDKKKDSTVKLQFWDVAEHERFLKMTAVYCR 130 >SB_22243| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 31.9 bits (69), Expect = 0.28 Identities = 10/23 (43%), Positives = 16/23 (69%) Frame = +1 Query: 394 VKFEIWDTAGQERYHSLAPMYYR 462 ++ +WDTAGQE + ++ YYR Sbjct: 34 IRLMLWDTAGQEEFDAITKAYYR 56 >SB_42281| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 31.5 bits (68), Expect = 0.36 Identities = 17/72 (23%), Positives = 38/72 (52%) Frame = +1 Query: 247 QFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAVFLTPAIRFDHTTVKFEIWDTAGQ 426 Q +++++G A GK++++ + G+ TIG F ++ + + + F +WD GQ Sbjct: 17 QMRILMVGLDAAGKTTILYKLKLGEIVT-TIPTIG--FNVESVEYKN--ISFTVWDVGGQ 71 Query: 427 ERYHSLAPMYYR 462 ++ L Y++ Sbjct: 72 DKIRPLWRHYFQ 83 >SB_33691| Best HMM Match : Ras (HMM E-Value=2.8e-13) Length = 270 Score = 31.5 bits (68), Expect = 0.36 Identities = 19/58 (32%), Positives = 29/58 (50%) Frame = +1 Query: 250 FKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAVFLTPAIRFDHTTVKFEIWDTAG 423 +K+ +LG VGK+SL+ F +F E T+ F+ ++ D I DTAG Sbjct: 13 YKISILGAGGVGKTSLLKTFFGHKFSEKHVPTVDDYFI-HSVNMDGVYYSTCIVDTAG 69 >SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 487 Score = 31.1 bits (67), Expect = 0.48 Identities = 21/90 (23%), Positives = 38/90 (42%) Frame = +1 Query: 187 ATNRTGAAQRPNGAPQTKVCQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAVFLT 366 AT R A + G+ V + ++++LG GKS + +G + +T F Sbjct: 146 ATKRQEADEEWEGSAGNSVPEKRILVLGLDGSGKSVFLSALSQGDSSKRPSTTKTEGFNV 205 Query: 367 PAIRFDHTTVKFEIWDTAGQERYHSLAPMY 456 + D + IW+ G E+Y + P + Sbjct: 206 VCLTTDG--LNLNIWEIGGDEKYRAYWPNF 233 >SB_58700| Best HMM Match : Ras (HMM E-Value=2.7e-15) Length = 857 Score = 30.7 bits (66), Expect = 0.64 Identities = 12/33 (36%), Positives = 23/33 (69%) Frame = +1 Query: 250 FKLVLLGESAVGKSSLVLRFVKGQFHEYQESTI 348 FK++++G+ VGK+SL+ R+V F + +T+ Sbjct: 672 FKVLVIGDLGVGKTSLIKRYVHQFFSVHYRATV 704 >SB_37042| Best HMM Match : Arf (HMM E-Value=0) Length = 188 Score = 30.7 bits (66), Expect = 0.64 Identities = 19/73 (26%), Positives = 33/73 (45%) Frame = +1 Query: 247 QFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAVFLTPAIRFDHTTVKFEIWDTAGQ 426 Q ++V+LG A GK++++ + + STI + V IWD GQ Sbjct: 19 QVRIVMLGLDAAGKTTILYKLKLKE----TVSTIPTIGFNVETLQPTKNVTLTIWDVGGQ 74 Query: 427 ERYHSLAPMYYRG 465 ++ L Y++G Sbjct: 75 DKIRPLWRHYFQG 87 >SB_11310| Best HMM Match : Arf (HMM E-Value=0) Length = 255 Score = 30.7 bits (66), Expect = 0.64 Identities = 15/72 (20%), Positives = 37/72 (51%) Frame = +1 Query: 247 QFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAVFLTPAIRFDHTTVKFEIWDTAGQ 426 + +L+++G A GK++++ + +TI + + ++ +KF +WD GQ Sbjct: 90 ELRLLMVGLDAAGKTTILYHLKLDE----PVNTIPTIGFNVEV-VEYKNIKFTVWDIGGQ 144 Query: 427 ERYHSLAPMYYR 462 ++ L +Y++ Sbjct: 145 DKIRLLWRLYFQ 156 >SB_5178| Best HMM Match : Ras (HMM E-Value=9e-10) Length = 166 Score = 30.7 bits (66), Expect = 0.64 Identities = 13/32 (40%), Positives = 21/32 (65%) Frame = +1 Query: 253 KLVLLGESAVGKSSLVLRFVKGQFHEYQESTI 348 ++ + G + VGK+S+V RF G+F E E T+ Sbjct: 10 EIAVFGGAGVGKTSIVKRFYCGKFSEEYEPTV 41 >SB_38579| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 30.3 bits (65), Expect = 0.84 Identities = 17/58 (29%), Positives = 34/58 (58%) Frame = +1 Query: 247 QFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAVFLTPAIRFDHTTVKFEIWDTA 420 ++KL ++G++ GK+SL+ VK E +E+ I +T D + ++F +WD++ Sbjct: 61 RYKLSVVGDAESGKTSLLNALVKSDI-EVEETVIFEECVTDVTSGD-SNLEFMLWDSS 116 >SB_49252| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 384 Score = 30.3 bits (65), Expect = 0.84 Identities = 23/77 (29%), Positives = 36/77 (46%), Gaps = 5/77 (6%) Frame = +1 Query: 247 QFKLVLLGESAVGKSSLVLRFVKGQFH-----EYQESTIGAVFLTPAIRFDHTTVKFEIW 411 Q+K+VL+G++ VGKS ++ R H Y+ +T G A H + Sbjct: 13 QYKVVLVGDAGVGKSFVIDRLNSTSEHWQGSRLYKPTTGGHASYFTASNSCH----LYLL 68 Query: 412 DTAGQERYHSLAPMYYR 462 DT+G E Y L +Y + Sbjct: 69 DTSGLEEYRELTKIYLK 85 >SB_56255| Best HMM Match : Arf (HMM E-Value=0) Length = 181 Score = 29.9 bits (64), Expect = 1.1 Identities = 16/72 (22%), Positives = 37/72 (51%) Frame = +1 Query: 247 QFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAVFLTPAIRFDHTTVKFEIWDTAGQ 426 + +++++G A GK++++ + G+ TIG F + + + + F +WD GQ Sbjct: 17 EMRILMVGLDAAGKTTILYKLKLGEIVT-TIPTIG--FNVETVEYKN--ISFTVWDVGGQ 71 Query: 427 ERYHSLAPMYYR 462 ++ L Y++ Sbjct: 72 DKIRPLWRHYFQ 83 >SB_53421| Best HMM Match : Arf (HMM E-Value=0) Length = 625 Score = 29.9 bits (64), Expect = 1.1 Identities = 9/27 (33%), Positives = 17/27 (62%) Frame = +1 Query: 385 HTTVKFEIWDTAGQERYHSLAPMYYRG 465 + + F +WD GQ++ +L +YY+G Sbjct: 37 YKNISFTVWDIGGQDKIRALWRVYYQG 63 >SB_35038| Best HMM Match : Ras (HMM E-Value=6.8e-13) Length = 322 Score = 29.9 bits (64), Expect = 1.1 Identities = 18/53 (33%), Positives = 27/53 (50%), Gaps = 2/53 (3%) Frame = +1 Query: 241 VCQFKLVLLGESAVGKSSLVLRFVKGQFH--EYQESTIGAVFLTPAIRFDHTT 393 V + K+++ G+S VGKS+LV F H + T+GA L + TT Sbjct: 3 VLRAKVLVTGDSCVGKSALVQVFQSDGTHYPKNYTQTVGAEVLVKLVNIPETT 55 >SB_29635| Best HMM Match : E-MAP-115 (HMM E-Value=1.2) Length = 2658 Score = 29.9 bits (64), Expect = 1.1 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = -2 Query: 407 ISNLTVVWSNRMAGVRNTAPMVLSWYSWNCPL 312 I+ L + WSN +G + P WY + PL Sbjct: 146 ITTLRLSWSNNASGTGQSLPFTAKWYMFRHPL 177 >SB_59261| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 5445 Score = 29.5 bits (63), Expect = 1.5 Identities = 13/41 (31%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = -1 Query: 252 ELADFCLWSAI-GPLCGSGPVCRHIPPCHCSSVLNFLLGRQ 133 E+ DFC +++ GP C +G VC + P + + GR+ Sbjct: 4434 EIRDFCALASVNGPACFNGGVCTNTPTSYTCTCARGFHGRR 4474 >SB_56941| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1034 Score = 29.1 bits (62), Expect = 1.9 Identities = 19/70 (27%), Positives = 33/70 (47%), Gaps = 2/70 (2%) Frame = +1 Query: 160 GATMTGRDMATNRTGAAQRPNG--APQTKVCQFKLVLLGESAVGKSSLVLRFVKGQFHEY 333 G ++ ++ ++ + +PN AP + + LLG AV SSL F F + Sbjct: 840 GVSIVQLQSSSTKSSSTSQPNATMAPSANLATKQNALLGFGAVVMSSLCSGFAGVYFEKI 899 Query: 334 QESTIGAVFL 363 + T G+V+L Sbjct: 900 LKGTSGSVWL 909 >SB_31919| Best HMM Match : ArgK (HMM E-Value=7.6e-15) Length = 415 Score = 29.1 bits (62), Expect = 1.9 Identities = 15/41 (36%), Positives = 22/41 (53%) Frame = +1 Query: 256 LVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAVFLTPAIR 378 L + G GKSSLV V+ ++ E TIG + + P+ R Sbjct: 86 LGITGTGGAGKSSLVDELVRRFLIDFPEKTIGLISVDPSKR 126 >SB_44360| Best HMM Match : Ion_trans (HMM E-Value=1.99993e-41) Length = 373 Score = 29.1 bits (62), Expect = 1.9 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = -2 Query: 212 CAAPVLFVAISLPVIVAPF*TFYLGDRSS 126 C + ++F+A+ +P IV+ F FY R S Sbjct: 282 CISGIIFIALPIPTIVSNFSQFYKDQRKS 310 >SB_39378| Best HMM Match : VWA (HMM E-Value=0) Length = 2865 Score = 29.1 bits (62), Expect = 1.9 Identities = 13/37 (35%), Positives = 21/37 (56%), Gaps = 2/37 (5%) Frame = -1 Query: 252 ELADFCLWSAI-GPLCGSGPVCRHIPPCH-CSSVLNF 148 E+ DFC +++ GP C +G VC + P + C+ F Sbjct: 2650 EIRDFCALASVNGPACFNGGVCTNTPTSYTCTCARGF 2686 >SB_7861| Best HMM Match : MMR_HSR1 (HMM E-Value=0.96) Length = 244 Score = 29.1 bits (62), Expect = 1.9 Identities = 19/50 (38%), Positives = 24/50 (48%) Frame = +1 Query: 199 TGAAQRPNGAPQTKVCQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTI 348 T Q +G P FK+ +LG SAVGK+SL+ K F TI Sbjct: 174 TSNIQMGSGLPPV---DFKMAILGGSAVGKTSLMRALFKKPFTNEHIPTI 220 >SB_17523| Best HMM Match : MMR_HSR1 (HMM E-Value=4.2) Length = 87 Score = 28.7 bits (61), Expect = 2.6 Identities = 15/36 (41%), Positives = 21/36 (58%) Frame = +1 Query: 220 NGAPQTKVCQFKLVLLGESAVGKSSLVLRFVKGQFH 327 + A TKV +K+V G VGK+SL LR +F+ Sbjct: 18 SSANHTKVPLYKVVFAGFRGVGKTSLFLRIRDEKFY 53 >SB_52502| Best HMM Match : GTP_CDC (HMM E-Value=1.9e-06) Length = 101 Score = 28.3 bits (60), Expect = 3.4 Identities = 18/74 (24%), Positives = 35/74 (47%), Gaps = 3/74 (4%) Frame = +1 Query: 193 NRTGAAQRPNGAPQTKV---CQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAVFL 363 N G A PN + V +F L+++GES +GKS+L+ + ++ + Sbjct: 3 NYVGFANLPNQVHRKSVKKGFEFTLMVVGESGLGKSTLIDSLFLTDLYSDRKILSAEERI 62 Query: 364 TPAIRFDHTTVKFE 405 ++ + +TV+ E Sbjct: 63 KKTVKIETSTVEIE 76 >SB_8803| Best HMM Match : Ras (HMM E-Value=7.9e-30) Length = 517 Score = 28.3 bits (60), Expect = 3.4 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = +1 Query: 409 WDTAGQERYHSLAPMYYRGA 468 W+ AGQER+ ++ YYRGA Sbjct: 374 WE-AGQERFRTITSSYYRGA 392 >SB_15207| Best HMM Match : Arf (HMM E-Value=1.9e-05) Length = 259 Score = 27.9 bits (59), Expect = 4.5 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +1 Query: 382 DHTTVKFEIWDTAGQERYHSLAPMYY 459 +H ++KF IWD G ++ L YY Sbjct: 229 EHRSLKFTIWDVGGLQKLRPLWRHYY 254 >SB_43575| Best HMM Match : Sina (HMM E-Value=0) Length = 432 Score = 27.9 bits (59), Expect = 4.5 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = +1 Query: 412 DTAGQERYHSLAPMYYRGA 468 DTAG+E+Y L+ Y RGA Sbjct: 278 DTAGEEKYAGLSSFYCRGA 296 >SB_32192| Best HMM Match : Guanylin (HMM E-Value=4.9) Length = 160 Score = 27.9 bits (59), Expect = 4.5 Identities = 22/71 (30%), Positives = 31/71 (43%), Gaps = 1/71 (1%) Frame = +3 Query: 186 GDKQDRSRTEAQWRSTDKSLPVQAGVVGR-VCGRQVLAGAPIRQGTVPRVPGEHHRGCVP 362 GD +S ++ +S D V GV+ C + G+P R+ V RV G RG +P Sbjct: 83 GDLPSQSTNDSTNQSADAM--VSRGVMSDGECVSRGYVGSPARRNVVSRVSGPPARGALP 140 Query: 363 NPGHSIRPHHR 395 S H R Sbjct: 141 PTPPSGGRHSR 151 >SB_52469| Best HMM Match : MSSP (HMM E-Value=0.54) Length = 341 Score = 27.5 bits (58), Expect = 5.9 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = -1 Query: 237 CLWSAIGPLCGSGPVCRHI 181 C ++GPL GPVC+H+ Sbjct: 11 CKHVSMGPLTTGGPVCKHV 29 Score = 27.5 bits (58), Expect = 5.9 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = -1 Query: 237 CLWSAIGPLCGSGPVCRHI 181 C +GPL GPVC+HI Sbjct: 289 CKHVGMGPLTTGGPVCKHI 307 Score = 27.5 bits (58), Expect = 5.9 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = -1 Query: 237 CLWSAIGPLCGSGPVCRHI 181 C +GPL GPVC+HI Sbjct: 304 CKHIGMGPLTTGGPVCKHI 322 Score = 27.1 bits (57), Expect = 7.8 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -1 Query: 237 CLWSAIGPLCGSGPVCRHI 181 C +GPL GPVC+H+ Sbjct: 26 CKHVGMGPLTTGGPVCKHV 44 Score = 27.1 bits (57), Expect = 7.8 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -1 Query: 237 CLWSAIGPLCGSGPVCRHI 181 C +GPL GPVC+H+ Sbjct: 71 CKHVGMGPLTTGGPVCKHV 89 Score = 27.1 bits (57), Expect = 7.8 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -1 Query: 237 CLWSAIGPLCGSGPVCRHI 181 C +GPL GPVC+H+ Sbjct: 150 CKHVGMGPLTTGGPVCKHV 168 Score = 27.1 bits (57), Expect = 7.8 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -1 Query: 237 CLWSAIGPLCGSGPVCRHI 181 C +GPL GPVC+H+ Sbjct: 214 CKHVGMGPLTTGGPVCKHV 232 Score = 27.1 bits (57), Expect = 7.8 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -1 Query: 237 CLWSAIGPLCGSGPVCRHI 181 C +GPL GPVC+H+ Sbjct: 259 CKHVGMGPLTTGGPVCKHV 277 >SB_31699| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 6119 Score = 27.5 bits (58), Expect = 5.9 Identities = 16/53 (30%), Positives = 29/53 (54%) Frame = +3 Query: 78 LFKCVINDNFGVTATS*RSVAQVKSSERSYNDREGYGDKQDRSRTEAQWRSTD 236 +FKCV+ ++FG+ + S + V+ E SY++ + DR+ + RS D Sbjct: 4953 IFKCVLLNDFGIASCS--AEILVEEDEESYSESSA-DEATDRNARIERRRSRD 5002 >SB_20852| Best HMM Match : PC_rep (HMM E-Value=1.8e-13) Length = 638 Score = 27.5 bits (58), Expect = 5.9 Identities = 23/112 (20%), Positives = 45/112 (40%), Gaps = 3/112 (2%) Frame = +3 Query: 132 SVAQVKSSERSYNDREGYGDKQDRSRTEAQWRSTDKSLPVQAGV-VGRVCGRQVLAGAPI 308 + + K +E+ E + + E + DK L + + V R+ R V P Sbjct: 5 AATEQKKTEKESKKDEAKAKDEPKREEEVELSEEDKLLQEELTMLVERLKERNVSLHKPA 64 Query: 309 RQGTVPRVPGE-HHRGCVPNPGHSIRPHHR*IRDLGYSW-TGEVSQLSADVL 458 + ++ VP P +RPH+ ++++ W GE + AD++ Sbjct: 65 LEALRSQIRASTSSMTSVPKPLKFLRPHYASMKEVYQGWPDGENKRFLADII 116 >SB_57342| Best HMM Match : Arf (HMM E-Value=0) Length = 457 Score = 27.5 bits (58), Expect = 5.9 Identities = 9/25 (36%), Positives = 15/25 (60%) Frame = +1 Query: 394 VKFEIWDTAGQERYHSLAPMYYRGA 468 + F +WD GQ++ L Y++GA Sbjct: 154 ITFSVWDIGGQDKIRRLWRHYFQGA 178 >SB_54000| Best HMM Match : MMR_HSR1 (HMM E-Value=1.8) Length = 65 Score = 27.5 bits (58), Expect = 5.9 Identities = 13/35 (37%), Positives = 23/35 (65%) Frame = +1 Query: 253 KLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAV 357 K++L+G+S VGK+ L+L F+ + Q T G++ Sbjct: 14 KVLLIGDSNVGKTKLLLTFLGQESIVQQMPTAGSL 48 >SB_37124| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 60 Score = 27.5 bits (58), Expect = 5.9 Identities = 12/26 (46%), Positives = 20/26 (76%) Frame = +1 Query: 253 KLVLLGESAVGKSSLVLRFVKGQFHE 330 K+VLLG+ GK+SLV R++ +F++ Sbjct: 29 KVVLLGKEYSGKTSLVERYLHHRFND 54 >SB_31930| Best HMM Match : RVT_1 (HMM E-Value=1.3e-33) Length = 405 Score = 27.5 bits (58), Expect = 5.9 Identities = 19/57 (33%), Positives = 29/57 (50%) Frame = -2 Query: 341 LSWYSWNCPLTNRSTSEDLPTADSPNNTSLNWQTFVCGAPLGLCAAPVLFVAISLPV 171 L+W+ N LTNR+ + N SL+ Q +CG PLG P+L+ + P+ Sbjct: 252 LAWF--NSYLTNRTQFVKIG-----NGFSLS-QKMLCGVPLGSVLGPMLYSLYTAPL 300 >SB_1645| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 244 Score = 27.5 bits (58), Expect = 5.9 Identities = 18/76 (23%), Positives = 30/76 (39%), Gaps = 5/76 (6%) Frame = +1 Query: 253 KLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAVFLTPAIRFDH-----TTVKFEIWDT 417 ++ ++G+S VGK+SLV + TIG + T E WD Sbjct: 8 RIAVVGDSGVGKTSLVHLICHEESISSAAWTIGCTVEVKLYDYKEGMPGGKTFFLEFWDI 67 Query: 418 AGQERYHSLAPMYYRG 465 G + + ++Y G Sbjct: 68 GGSANHENSRSIFYNG 83 >SB_56373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 629 Score = 27.1 bits (57), Expect = 7.8 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = -2 Query: 296 SEDLPTADSPNNTSLNWQTFVCGAPL 219 +E P +SP NT ++ TFV PL Sbjct: 431 TESSPDGESPKNTDIDGHTFVIKEPL 456 >SB_52511| Best HMM Match : RVT_1 (HMM E-Value=0.00044) Length = 513 Score = 27.1 bits (57), Expect = 7.8 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = -2 Query: 266 NNTSLNWQTFVCGAPLGLCAAPVLFV 189 N TS +W + G P G P LF+ Sbjct: 337 NGTSSDWSPVISGVPQGTMLGPTLFL 362 >SB_1242| Best HMM Match : DUF590 (HMM E-Value=4.2e-05) Length = 195 Score = 27.1 bits (57), Expect = 7.8 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -2 Query: 344 VLSWYSWNCPLTNRSTSE 291 V++W WNC T R T+E Sbjct: 117 VIAWDDWNCKTTARRTTE 134 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,298,884 Number of Sequences: 59808 Number of extensions: 368380 Number of successful extensions: 1215 Number of sequences better than 10.0: 94 Number of HSP's better than 10.0 without gapping: 1120 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1205 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 982083920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -