BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0633 (597 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF225975-2|AAF74116.1| 302|Tribolium castaneum Tc-tailless prot... 24 1.1 AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholo... 24 1.1 Z69735-1|CAA93623.1| 162|Tribolium castaneum initiation factor ... 21 7.9 AJ888865-1|CAI61930.1| 108|Tribolium castaneum modulator of act... 21 7.9 AJ622939-1|CAF22091.1| 108|Tribolium castaneum ETS activity mod... 21 7.9 >AF225975-2|AAF74116.1| 302|Tribolium castaneum Tc-tailless protein. Length = 302 Score = 23.8 bits (49), Expect = 1.1 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = +2 Query: 65 FSRSVRRIRQLTCRA 109 F RS+RR RQ C+A Sbjct: 62 FKRSIRRNRQYVCKA 76 >AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholog protein. Length = 406 Score = 23.8 bits (49), Expect = 1.1 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = +2 Query: 65 FSRSVRRIRQLTCRA 109 F RS+RR RQ C+A Sbjct: 62 FKRSIRRNRQYVCKA 76 >Z69735-1|CAA93623.1| 162|Tribolium castaneum initiation factor 5-like protein protein. Length = 162 Score = 21.0 bits (42), Expect = 7.9 Identities = 8/16 (50%), Positives = 9/16 (56%) Frame = -2 Query: 59 DD*VRKFAHAAECTNP 12 D +RKF EC NP Sbjct: 4 DGFIRKFVLCPECENP 19 >AJ888865-1|CAI61930.1| 108|Tribolium castaneum modulator of activity of ets genes protein. Length = 108 Score = 21.0 bits (42), Expect = 7.9 Identities = 12/44 (27%), Positives = 20/44 (45%) Frame = +1 Query: 22 HSAAWANFLTQSSELLKICS*NSSAHLQGLC*ILVSILTSATGL 153 H A W N +TQ L ++ S + + LC + + + S L Sbjct: 43 HVAQWINLVTQQHGLPEVPSSRFLMNGKALCLMSLGMFLSRVPL 86 >AJ622939-1|CAF22091.1| 108|Tribolium castaneum ETS activity modulator protein. Length = 108 Score = 21.0 bits (42), Expect = 7.9 Identities = 12/44 (27%), Positives = 20/44 (45%) Frame = +1 Query: 22 HSAAWANFLTQSSELLKICS*NSSAHLQGLC*ILVSILTSATGL 153 H A W N +TQ L ++ S + + LC + + + S L Sbjct: 43 HVAQWINLVTQQHGLPEVPSSRFLMNGKALCLMSLGMFLSRVPL 86 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 149,300 Number of Sequences: 336 Number of extensions: 3155 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15039504 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -