BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0633 (597 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1F7.09c |||allantoicase |Schizosaccharomyces pombe|chr 1|||M... 35 0.010 SPBC31F10.11c |cwf4|syf3|complexed with Cdc5 protein Cwf4 |Schiz... 27 1.6 SPCC622.11 |||LMBR1-like membrane protein|Schizosaccharomyces po... 27 2.1 SPAC1805.10 |||sequence orphan|Schizosaccharomyces pombe|chr 1||... 26 3.6 SPAC30D11.01c ||SPAC56F8.01|alpha-glucosidase|Schizosaccharomyce... 26 4.8 SPAC27F1.05c |||aminotransferase class-III, unknown specificty|S... 25 6.3 SPCC297.03 |ssp1||serine/threonine protein kinase Ssp1 |Schizosa... 25 6.3 >SPAC1F7.09c |||allantoicase |Schizosaccharomyces pombe|chr 1|||Manual Length = 342 Score = 34.7 bits (76), Expect = 0.010 Identities = 16/52 (30%), Positives = 23/52 (44%), Gaps = 2/52 (3%) Frame = +3 Query: 54 IIGTSQDLFV--EFVSSPAGPLLNTGFHFNVGNWPGHVEARGSRVGTCDWLL 203 ++G S D F E + +PA P+ G G W E R CDW++ Sbjct: 34 VLGCSDDFFASCENLINPADPIRKAGVFVETGAWYDGWETRRHNTAPCDWVI 85 >SPBC31F10.11c |cwf4|syf3|complexed with Cdc5 protein Cwf4 |Schizosaccharomyces pombe|chr 2|||Manual Length = 674 Score = 27.5 bits (58), Expect = 1.6 Identities = 11/39 (28%), Positives = 22/39 (56%) Frame = +2 Query: 254 RCALVSSSYLMYLPDARIPWTGCEAVLSQVRKQIQLRNL 370 RC ++ +++Y P+A PW G A+ +++ + R L Sbjct: 452 RCRILYEKWILYDPEACAPWLGYAALETKLGDSDRARAL 490 >SPCC622.11 |||LMBR1-like membrane protein|Schizosaccharomyces pombe|chr 3|||Manual Length = 562 Score = 27.1 bits (57), Expect = 2.1 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = +2 Query: 233 HGRHIPVRCALVSSSYLMYLPDARIP 310 + R + ++ A S SY +YLPD+ IP Sbjct: 308 YNRIMLIKTAKASGSYRLYLPDSYIP 333 >SPAC1805.10 |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 527 Score = 26.2 bits (55), Expect = 3.6 Identities = 6/23 (26%), Positives = 18/23 (78%) Frame = +1 Query: 352 NTITQSEAVFVNLLSPCPNENII 420 NT++ + ++F++++ PCP +++ Sbjct: 135 NTLSLTPSIFLSVMKPCPKTSVL 157 >SPAC30D11.01c ||SPAC56F8.01|alpha-glucosidase|Schizosaccharomyces pombe|chr 1|||Manual Length = 993 Score = 25.8 bits (54), Expect = 4.8 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = -3 Query: 241 PSVSPDFFKDSAVSNQSQVPTLDP 170 P+ + DFF+ S+Q VP LDP Sbjct: 392 PNQTLDFFRSLDESHQHYVPVLDP 415 >SPAC27F1.05c |||aminotransferase class-III, unknown specificty|Schizosaccharomyces pombe|chr 1|||Manual Length = 484 Score = 25.4 bits (53), Expect = 6.3 Identities = 12/38 (31%), Positives = 18/38 (47%) Frame = +2 Query: 242 HIPVRCALVSSSYLMYLPDARIPWTGCEAVLSQVRKQI 355 H+ V C+L + S +LP IP + LS V + Sbjct: 431 HVQVYCSLNNPSVFRFLPPLTIPEADLDEGLSAVESAV 468 >SPCC297.03 |ssp1||serine/threonine protein kinase Ssp1 |Schizosaccharomyces pombe|chr 3|||Manual Length = 652 Score = 25.4 bits (53), Expect = 6.3 Identities = 14/40 (35%), Positives = 21/40 (52%), Gaps = 1/40 (2%) Frame = +2 Query: 281 LMYLPDARIPWTGCEA-VLSQVRKQIQLRNLKLSL*TYCH 397 L Y+ +PWT C++ VLS + R++ L L Y H Sbjct: 221 LEYMSGGEVPWTDCDSPVLSISEARQYFRDVVLGL-EYLH 259 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,576,941 Number of Sequences: 5004 Number of extensions: 52358 Number of successful extensions: 106 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 102 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 106 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 260219058 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -