BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0633 (597 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC050329-1|AAH50329.1| 533|Homo sapiens NETO1 protein protein. 31 3.1 AF448839-1|AAM18027.1| 156|Homo sapiens neuropilin and tolloid ... 31 3.1 AF448838-1|AAM18026.1| 533|Homo sapiens neuropilin and tolloid ... 31 3.1 BC113577-1|AAI13578.1| 1015|Homo sapiens tolloid-like 2 protein. 30 5.4 BC112366-1|AAI12367.1| 1015|Homo sapiens tolloid-like 2 protein. 30 5.4 BC112341-1|AAI12342.1| 1015|Homo sapiens tolloid-like 2 protein. 30 5.4 BC013871-1|AAH13871.1| 593|Homo sapiens TLL2 protein protein. 30 5.4 AL391136-1|CAH72234.1| 1015|Homo sapiens tolloid-like 2 protein. 30 5.4 AL138765-2|CAI13580.1| 1015|Homo sapiens tolloid-like 2 protein. 30 5.4 AL136181-1|CAH72983.1| 1015|Homo sapiens tolloid-like 2 protein. 30 5.4 AF059516-1|AAD42979.1| 1015|Homo sapiens tolloid-like 2 protein ... 30 5.4 AB023149-1|BAA76776.2| 1078|Homo sapiens KIAA0932 protein protein. 30 5.4 BC139923-1|AAI39924.1| 467|Homo sapiens ATRNL1 protein protein. 29 9.5 BC139916-1|AAI39917.1| 467|Homo sapiens ATRNL1 protein protein. 29 9.5 BC047716-1|AAH47716.1| 467|Homo sapiens ATRNL1 protein protein. 29 9.5 AY442317-1|AAR14297.1| 1379|Homo sapiens attractin-like protein ... 29 9.5 AL512304-1|CAH74015.2| 1379|Homo sapiens attractin-like 1 protein. 29 9.5 AL392087-1|CAI40794.2| 1379|Homo sapiens attractin-like 1 protein. 29 9.5 AL357059-1|CAH70625.2| 1379|Homo sapiens attractin-like 1 protein. 29 9.5 AL356100-1|CAI40417.2| 1379|Homo sapiens attractin-like 1 protein. 29 9.5 AL355530-2|CAI13482.1| 476|Homo sapiens attractin-like 1 protein. 29 9.5 AL355530-1|CAI13483.2| 1379|Homo sapiens attractin-like 1 protein. 29 9.5 >BC050329-1|AAH50329.1| 533|Homo sapiens NETO1 protein protein. Length = 533 Score = 31.1 bits (67), Expect = 3.1 Identities = 14/34 (41%), Positives = 19/34 (55%), Gaps = 2/34 (5%) Frame = +3 Query: 240 GIFLSVAH--WYPPHTSCTYLMQGFPGQVVRLYF 335 GIF S + YPP C Y+++ P Q + LYF Sbjct: 51 GIFTSPNYPSKYPPDRECIYIIEAAPRQCIELYF 84 >AF448839-1|AAM18027.1| 156|Homo sapiens neuropilin and tolloid like-1 protein. Length = 156 Score = 31.1 bits (67), Expect = 3.1 Identities = 14/34 (41%), Positives = 19/34 (55%), Gaps = 2/34 (5%) Frame = +3 Query: 240 GIFLSVAH--WYPPHTSCTYLMQGFPGQVVRLYF 335 GIF S + YPP C Y+++ P Q + LYF Sbjct: 50 GIFTSPNYPSKYPPDRECIYIIEAAPRQCIELYF 83 >AF448838-1|AAM18026.1| 533|Homo sapiens neuropilin and tolloid like-1 protein. Length = 533 Score = 31.1 bits (67), Expect = 3.1 Identities = 14/34 (41%), Positives = 19/34 (55%), Gaps = 2/34 (5%) Frame = +3 Query: 240 GIFLSVAH--WYPPHTSCTYLMQGFPGQVVRLYF 335 GIF S + YPP C Y+++ P Q + LYF Sbjct: 51 GIFTSPNYPSKYPPDRECIYIIEAAPRQCIELYF 84 >BC113577-1|AAI13578.1| 1015|Homo sapiens tolloid-like 2 protein. Length = 1015 Score = 30.3 bits (65), Expect = 5.4 Identities = 17/40 (42%), Positives = 22/40 (55%) Frame = +3 Query: 9 PRIGTFCGMGKFPYSIIGTSQDLFVEFVSSPAGPLLNTGF 128 P +G FCG K P ++ T L+VEF SS +L GF Sbjct: 420 PLLGRFCG-DKIPEPLVSTDSRLWVEFRSS--SNILGKGF 456 >BC112366-1|AAI12367.1| 1015|Homo sapiens tolloid-like 2 protein. Length = 1015 Score = 30.3 bits (65), Expect = 5.4 Identities = 17/40 (42%), Positives = 22/40 (55%) Frame = +3 Query: 9 PRIGTFCGMGKFPYSIIGTSQDLFVEFVSSPAGPLLNTGF 128 P +G FCG K P ++ T L+VEF SS +L GF Sbjct: 420 PLLGRFCG-DKIPEPLVSTDSRLWVEFRSS--SNILGKGF 456 >BC112341-1|AAI12342.1| 1015|Homo sapiens tolloid-like 2 protein. Length = 1015 Score = 30.3 bits (65), Expect = 5.4 Identities = 17/40 (42%), Positives = 22/40 (55%) Frame = +3 Query: 9 PRIGTFCGMGKFPYSIIGTSQDLFVEFVSSPAGPLLNTGF 128 P +G FCG K P ++ T L+VEF SS +L GF Sbjct: 420 PLLGRFCG-DKIPEPLVSTDSRLWVEFRSS--SNILGKGF 456 >BC013871-1|AAH13871.1| 593|Homo sapiens TLL2 protein protein. Length = 593 Score = 30.3 bits (65), Expect = 5.4 Identities = 17/40 (42%), Positives = 22/40 (55%) Frame = +3 Query: 9 PRIGTFCGMGKFPYSIIGTSQDLFVEFVSSPAGPLLNTGF 128 P +G FCG K P ++ T L+VEF SS +L GF Sbjct: 420 PLLGRFCG-DKIPEPLVSTDSRLWVEFRSS--SNILGKGF 456 >AL391136-1|CAH72234.1| 1015|Homo sapiens tolloid-like 2 protein. Length = 1015 Score = 30.3 bits (65), Expect = 5.4 Identities = 17/40 (42%), Positives = 22/40 (55%) Frame = +3 Query: 9 PRIGTFCGMGKFPYSIIGTSQDLFVEFVSSPAGPLLNTGF 128 P +G FCG K P ++ T L+VEF SS +L GF Sbjct: 420 PLLGRFCG-DKIPEPLVSTDSRLWVEFRSS--SNILGKGF 456 >AL138765-2|CAI13580.1| 1015|Homo sapiens tolloid-like 2 protein. Length = 1015 Score = 30.3 bits (65), Expect = 5.4 Identities = 17/40 (42%), Positives = 22/40 (55%) Frame = +3 Query: 9 PRIGTFCGMGKFPYSIIGTSQDLFVEFVSSPAGPLLNTGF 128 P +G FCG K P ++ T L+VEF SS +L GF Sbjct: 420 PLLGRFCG-DKIPEPLVSTDSRLWVEFRSS--SNILGKGF 456 >AL136181-1|CAH72983.1| 1015|Homo sapiens tolloid-like 2 protein. Length = 1015 Score = 30.3 bits (65), Expect = 5.4 Identities = 17/40 (42%), Positives = 22/40 (55%) Frame = +3 Query: 9 PRIGTFCGMGKFPYSIIGTSQDLFVEFVSSPAGPLLNTGF 128 P +G FCG K P ++ T L+VEF SS +L GF Sbjct: 420 PLLGRFCG-DKIPEPLVSTDSRLWVEFRSS--SNILGKGF 456 >AF059516-1|AAD42979.1| 1015|Homo sapiens tolloid-like 2 protein protein. Length = 1015 Score = 30.3 bits (65), Expect = 5.4 Identities = 17/40 (42%), Positives = 22/40 (55%) Frame = +3 Query: 9 PRIGTFCGMGKFPYSIIGTSQDLFVEFVSSPAGPLLNTGF 128 P +G FCG K P ++ T L+VEF SS +L GF Sbjct: 420 PLLGRFCG-DKIPEPLVSTDSRLWVEFRSS--SNILGKGF 456 >AB023149-1|BAA76776.2| 1078|Homo sapiens KIAA0932 protein protein. Length = 1078 Score = 30.3 bits (65), Expect = 5.4 Identities = 17/40 (42%), Positives = 22/40 (55%) Frame = +3 Query: 9 PRIGTFCGMGKFPYSIIGTSQDLFVEFVSSPAGPLLNTGF 128 P +G FCG K P ++ T L+VEF SS +L GF Sbjct: 483 PLLGRFCG-DKIPEPLVSTDSRLWVEFRSS--SNILGKGF 519 >BC139923-1|AAI39924.1| 467|Homo sapiens ATRNL1 protein protein. Length = 467 Score = 29.5 bits (63), Expect = 9.5 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = +3 Query: 267 YPPHTSCTYLMQGFPGQVVRLYF 335 Y T CT+L++G+P V+RL F Sbjct: 113 YKYKTKCTWLIEGYPNAVLRLRF 135 >BC139916-1|AAI39917.1| 467|Homo sapiens ATRNL1 protein protein. Length = 467 Score = 29.5 bits (63), Expect = 9.5 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = +3 Query: 267 YPPHTSCTYLMQGFPGQVVRLYF 335 Y T CT+L++G+P V+RL F Sbjct: 113 YKYKTKCTWLIEGYPNAVLRLRF 135 >BC047716-1|AAH47716.1| 467|Homo sapiens ATRNL1 protein protein. Length = 467 Score = 29.5 bits (63), Expect = 9.5 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = +3 Query: 267 YPPHTSCTYLMQGFPGQVVRLYF 335 Y T CT+L++G+P V+RL F Sbjct: 113 YKYKTKCTWLIEGYPNAVLRLRF 135 >AY442317-1|AAR14297.1| 1379|Homo sapiens attractin-like protein protein. Length = 1379 Score = 29.5 bits (63), Expect = 9.5 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = +3 Query: 267 YPPHTSCTYLMQGFPGQVVRLYF 335 Y T CT+L++G+P V+RL F Sbjct: 113 YKYKTKCTWLIEGYPNAVLRLRF 135 >AL512304-1|CAH74015.2| 1379|Homo sapiens attractin-like 1 protein. Length = 1379 Score = 29.5 bits (63), Expect = 9.5 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = +3 Query: 267 YPPHTSCTYLMQGFPGQVVRLYF 335 Y T CT+L++G+P V+RL F Sbjct: 113 YKYKTKCTWLIEGYPNAVLRLRF 135 >AL392087-1|CAI40794.2| 1379|Homo sapiens attractin-like 1 protein. Length = 1379 Score = 29.5 bits (63), Expect = 9.5 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = +3 Query: 267 YPPHTSCTYLMQGFPGQVVRLYF 335 Y T CT+L++G+P V+RL F Sbjct: 113 YKYKTKCTWLIEGYPNAVLRLRF 135 >AL357059-1|CAH70625.2| 1379|Homo sapiens attractin-like 1 protein. Length = 1379 Score = 29.5 bits (63), Expect = 9.5 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = +3 Query: 267 YPPHTSCTYLMQGFPGQVVRLYF 335 Y T CT+L++G+P V+RL F Sbjct: 113 YKYKTKCTWLIEGYPNAVLRLRF 135 >AL356100-1|CAI40417.2| 1379|Homo sapiens attractin-like 1 protein. Length = 1379 Score = 29.5 bits (63), Expect = 9.5 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = +3 Query: 267 YPPHTSCTYLMQGFPGQVVRLYF 335 Y T CT+L++G+P V+RL F Sbjct: 113 YKYKTKCTWLIEGYPNAVLRLRF 135 >AL355530-2|CAI13482.1| 476|Homo sapiens attractin-like 1 protein. Length = 476 Score = 29.5 bits (63), Expect = 9.5 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = +3 Query: 267 YPPHTSCTYLMQGFPGQVVRLYF 335 Y T CT+L++G+P V+RL F Sbjct: 113 YKYKTKCTWLIEGYPNAVLRLRF 135 >AL355530-1|CAI13483.2| 1379|Homo sapiens attractin-like 1 protein. Length = 1379 Score = 29.5 bits (63), Expect = 9.5 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = +3 Query: 267 YPPHTSCTYLMQGFPGQVVRLYF 335 Y T CT+L++G+P V+RL F Sbjct: 113 YKYKTKCTWLIEGYPNAVLRLRF 135 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 93,194,538 Number of Sequences: 237096 Number of extensions: 1912034 Number of successful extensions: 3857 Number of sequences better than 10.0: 22 Number of HSP's better than 10.0 without gapping: 3594 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3857 length of database: 76,859,062 effective HSP length: 86 effective length of database: 56,468,806 effective search space used: 6324506272 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -