BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0632 (624 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC4F6.06 |kin1||microtubule affinity-regulating kinase Kin1 |S... 31 0.18 SPCC4G3.14 |mdj1||DNAJ domain protein Mdj1 |Schizosaccharomyces ... 27 2.2 SPCC1672.10 |mis16||kinetochore protein Mis16 |Schizosaccharomyc... 25 6.7 SPBC4B4.03 |rsc1||RSC complex subunit Rsc1 |Schizosaccharomyces ... 25 8.9 SPAC3F10.02c |trk1|sptrk|potassium ion transporter Trk1|Schizosa... 25 8.9 SPAC869.01 |||amidase |Schizosaccharomyces pombe|chr 1|||Manual 25 8.9 SPAC27E2.03c |||GTP binding protein |Schizosaccharomyces pombe|c... 25 8.9 SPBC1271.14 |||glutamate N-acetyltransferase |Schizosaccharomyce... 25 8.9 >SPBC4F6.06 |kin1||microtubule affinity-regulating kinase Kin1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 891 Score = 30.7 bits (66), Expect = 0.18 Identities = 17/41 (41%), Positives = 22/41 (53%) Frame = -3 Query: 286 SAWGPSFSVRSGCYSRMTSRSDLRDACSPGPGRLARRNPPP 164 SA G S SVR G Y+ ++S+ D + S GP N PP Sbjct: 653 SAIGRSTSVREGRYAGISSQMDSLNMDSTGPSASNMANAPP 693 >SPCC4G3.14 |mdj1||DNAJ domain protein Mdj1 |Schizosaccharomyces pombe|chr 3|||Manual Length = 528 Score = 27.1 bits (57), Expect = 2.2 Identities = 10/26 (38%), Positives = 18/26 (69%) Frame = +3 Query: 402 TGSNPDGTGSNRTGAALASRHGRGVS 479 T S+P GT S+ + ++ +S+H G+S Sbjct: 462 TQSSPSGTNSSTSTSSTSSKHSTGIS 487 >SPCC1672.10 |mis16||kinetochore protein Mis16 |Schizosaccharomyces pombe|chr 3|||Manual Length = 430 Score = 25.4 bits (53), Expect = 6.7 Identities = 8/15 (53%), Positives = 12/15 (80%) Frame = -1 Query: 591 HNITELINDVEFHSQ 547 H T+++NDV+FH Q Sbjct: 232 HRHTDIVNDVQFHPQ 246 >SPBC4B4.03 |rsc1||RSC complex subunit Rsc1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 803 Score = 25.0 bits (52), Expect = 8.9 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = -1 Query: 582 TELINDVEFHSQVGSCYIKYVTKY 511 T L D VG C++ Y+T+Y Sbjct: 415 TSLYRDHPVSEIVGRCFVMYITRY 438 >SPAC3F10.02c |trk1|sptrk|potassium ion transporter Trk1|Schizosaccharomyces pombe|chr 1|||Manual Length = 841 Score = 25.0 bits (52), Expect = 8.9 Identities = 12/34 (35%), Positives = 20/34 (58%) Frame = -1 Query: 123 VGVR*ILLPVNVRTVYWGLQELA*TFNDSEFSVV 22 VG R ++ ++R +W L A +FND FS++ Sbjct: 493 VGSREVIDSYDLRRGWWALFSSASSFNDLGFSLI 526 >SPAC869.01 |||amidase |Schizosaccharomyces pombe|chr 1|||Manual Length = 583 Score = 25.0 bits (52), Expect = 8.9 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = -1 Query: 315 DREGGVLQVPLHGVPHFPSGRGAT 244 +R G+++ PLHG+P AT Sbjct: 123 ERANGIIRGPLHGIPFIVKDNFAT 146 >SPAC27E2.03c |||GTP binding protein |Schizosaccharomyces pombe|chr 1|||Manual Length = 392 Score = 25.0 bits (52), Expect = 8.9 Identities = 12/22 (54%), Positives = 14/22 (63%), Gaps = 1/22 (4%) Frame = +1 Query: 190 DLALVNKHLEGL-SVTSSGCST 252 D V KHLEGL +TS G +T Sbjct: 155 DAEFVEKHLEGLRKITSRGANT 176 >SPBC1271.14 |||glutamate N-acetyltransferase |Schizosaccharomyces pombe|chr 2|||Manual Length = 445 Score = 25.0 bits (52), Expect = 8.9 Identities = 24/95 (25%), Positives = 41/95 (43%) Frame = +1 Query: 109 LSHADHDLLEPLSRDSPDRGEGSSVPTDLALVNKHLEGLSVTSSGCSTPTGRKMRDPMQR 288 L HA ++ +S D G+ S+ T L N G +T S +P +++RD + Sbjct: 246 LRHAINNSFNSISID----GDTSTNDTIAFLANGAAGGSEITKS---SPAYKEIRDAVTD 298 Query: 289 DLQNSTFSISKETEGLDTKTSVRVRNPPGGKSSGL 393 Q + ++ EG +V+VR K + L Sbjct: 299 IAQQLAKLVVRDGEGATKFVTVQVRGARSEKDAAL 333 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,622,163 Number of Sequences: 5004 Number of extensions: 55421 Number of successful extensions: 183 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 174 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 183 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 275671126 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -