BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0632 (624 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor typ... 31 0.012 DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholi... 23 2.4 DQ435333-1|ABD92648.1| 135|Apis mellifera OBP16 protein. 21 9.8 AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. 21 9.8 AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisp... 21 9.8 >AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor type D2 protein. Length = 456 Score = 30.7 bits (66), Expect = 0.012 Identities = 14/34 (41%), Positives = 20/34 (58%) Frame = -3 Query: 250 CYSRMTSRSDLRDACSPGPGRLARRNPPPYRGSP 149 C+SR R+ +R C+ PGR+ RR P +R P Sbjct: 392 CWSRDFRRAFVRILCACCPGRVRRRYQPAFRCKP 425 >DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholine receptor alpha1subunit protein. Length = 601 Score = 23.0 bits (47), Expect = 2.4 Identities = 13/40 (32%), Positives = 19/40 (47%), Gaps = 4/40 (10%) Frame = -1 Query: 321 FADREGGVLQVPLHGVP----HFPSGRGATAG*RHAQTFE 214 + +R G ++P HG+P + G AT G A FE Sbjct: 433 YGNRFSGEYEIPAHGLPPSATRYDLGAVATVGTTVAPCFE 472 >DQ435333-1|ABD92648.1| 135|Apis mellifera OBP16 protein. Length = 135 Score = 21.0 bits (42), Expect = 9.8 Identities = 8/10 (80%), Positives = 9/10 (90%) Frame = +1 Query: 556 KFNVVDQFGN 585 KFNVVD+ GN Sbjct: 69 KFNVVDENGN 78 >AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. Length = 996 Score = 21.0 bits (42), Expect = 9.8 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = +2 Query: 263 GK*GTPCRGTCKTPP 307 G+ G CRG K PP Sbjct: 642 GEFGDVCRGKLKLPP 656 >AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform A protein. Length = 782 Score = 21.0 bits (42), Expect = 9.8 Identities = 10/32 (31%), Positives = 16/32 (50%) Frame = -3 Query: 268 FSVRSGCYSRMTSRSDLRDACSPGPGRLARRN 173 F + +GC SR+++R G +RRN Sbjct: 26 FRISAGCVSRISNRISRNRVLLRGQCISSRRN 57 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 182,449 Number of Sequences: 438 Number of extensions: 4131 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18582456 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -