BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0631 (657 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_O75581 Cluster: Low-density lipoprotein receptor-relate... 33 4.6 >UniRef50_O75581 Cluster: Low-density lipoprotein receptor-related protein 6 precursor; n=30; Deuterostomia|Rep: Low-density lipoprotein receptor-related protein 6 precursor - Homo sapiens (Human) Length = 1613 Score = 33.5 bits (73), Expect = 4.6 Identities = 15/45 (33%), Positives = 24/45 (53%) Frame = -1 Query: 180 KCATPLEI*VLRSQYSYNGCPTLQAETHYCFTAEIDGVVVPNRAD 46 +C+ P+ + +L+ + S PT + CFT EID + V R D Sbjct: 1227 RCSCPMHLVLLQDELSCGEPPTCSPQQFTCFTGEIDCIPVAWRCD 1271 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 639,369,145 Number of Sequences: 1657284 Number of extensions: 12355795 Number of successful extensions: 22030 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 21591 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22028 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 49586781480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -