BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0631 (657 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_06_0708 + 26475306-26478404 29 3.3 11_06_0296 + 22046649-22048202,22048524-22048703,22048811-220488... 29 3.3 >11_06_0708 + 26475306-26478404 Length = 1032 Score = 29.1 bits (62), Expect = 3.3 Identities = 16/36 (44%), Positives = 22/36 (61%), Gaps = 2/36 (5%) Frame = +2 Query: 296 PRVMTRLSF*NMLDG--VGGGSKNTRSTTRYQVRSL 397 PR + RL F N L+G VGGGS NT+ + ++ L Sbjct: 652 PRGIGRLEFLNDLEGFPVGGGSDNTKMQDGWNLQEL 687 >11_06_0296 + 22046649-22048202,22048524-22048703,22048811-22048860, 22049443-22049564,22051007-22051119,22051227-22051436, 22052152-22052265,22052529-22052658,22053010-22053143, 22053997-22054077,22054181-22054267 Length = 924 Score = 29.1 bits (62), Expect = 3.3 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = -1 Query: 132 YNGCPTLQAETHYCFTAEIDGVVVPNRAD 46 + G +A H+CF +EI+G V+ + AD Sbjct: 759 FQGLHISEASLHFCFNSEIEGRVINSFAD 787 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,419,324 Number of Sequences: 37544 Number of extensions: 352333 Number of successful extensions: 677 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 659 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 677 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1644004708 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -