BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0631 (657 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g79190.1 68414.m09233 expressed protein 31 0.51 At3g01060.2 68416.m00007 expressed protein 27 8.3 >At1g79190.1 68414.m09233 expressed protein Length = 1274 Score = 31.5 bits (68), Expect = 0.51 Identities = 12/33 (36%), Positives = 20/33 (60%) Frame = +3 Query: 111 EGWGSRCNYTETLELISQGG*RICVVNVIVYGL 209 E W S CN T + +L+ Q C++N +++GL Sbjct: 621 EDWQSWCNRTGSGQLVRQAATAACILNEMIFGL 653 >At3g01060.2 68416.m00007 expressed protein Length = 442 Score = 27.5 bits (58), Expect = 8.3 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = -1 Query: 429 VTS*PSFKLYHKLRT*YLVVDRVFFDPPPTPSSM 328 V S P YHK LV D V F P PSS+ Sbjct: 223 VLSSPEVAFYHKRSRTLLVTDAVIFVPRKPPSSI 256 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,936,657 Number of Sequences: 28952 Number of extensions: 280441 Number of successful extensions: 484 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 479 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 484 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1373722560 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -