BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0624 (602 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g66850.1 68418.m08428 protein kinase family protein contains ... 32 0.34 At1g16610.2 68414.m01990 arginine/serine-rich protein, putative ... 30 1.0 At4g12480.1 68417.m01973 protease inhibitor/seed storage/lipid t... 28 4.1 At1g31290.1 68414.m03829 PAZ domain-containing protein / piwi do... 28 4.1 At1g02840.3 68414.m00246 pre-mRNA splicing factor SF2 (SF2) / SR... 28 5.5 At1g02840.1 68414.m00245 pre-mRNA splicing factor SF2 (SF2) / SR... 28 5.5 At2g29210.1 68415.m03550 splicing factor PWI domain-containing p... 27 7.2 At2g26670.1 68415.m03199 heme oxygenase 1 (HO1) (HY1) identical ... 27 7.2 At4g24790.1 68417.m03550 expressed protein ; expression supporte... 27 9.6 At1g62510.1 68414.m07053 protease inhibitor/seed storage/lipid t... 27 9.6 >At5g66850.1 68418.m08428 protein kinase family protein contains Pfam domain, PF00069: Protein kinase domain; identical to cDNA MAP3K gamma protein kinase GI:2315152 Length = 716 Score = 31.9 bits (69), Expect = 0.34 Identities = 19/54 (35%), Positives = 24/54 (44%) Frame = +1 Query: 277 PQNRNCR*ESSCSLPRRKAHPLPGRKENPLPRESARSPTLPRCQTCPLPS*RDC 438 PQ R+ R + P R + PL + PR+S SP PR T RDC Sbjct: 253 PQPRSPRKQIRSPQPSRPSSPLHSVDSSAPPRDSVSSPLHPRLSTDVTNGRRDC 306 >At1g16610.2 68414.m01990 arginine/serine-rich protein, putative (SR45) similar to arginine/serine-rich protein GI:6601502 from [Arabidopsis thaliana] Length = 407 Score = 30.3 bits (65), Expect = 1.0 Identities = 27/77 (35%), Positives = 33/77 (42%), Gaps = 5/77 (6%) Frame = +1 Query: 319 PRRKAHPLPGRKENPLPRES----ARSPTLPRCQTCPLPS*RDCQGTSSRTATLPSRKEG 486 PRR L R+ +PLPR RSP P + P R R PSR G Sbjct: 212 PRRPRERLSPRRRSPLPRRGLSPRRRSPDSPHRRRPGSPIRRRGDTPPRRRPASPSR--G 269 Query: 487 ALPSTCPSRQTR-PRQG 534 PS+ P R+ R P +G Sbjct: 270 RSPSSPPPRRYRSPPRG 286 >At4g12480.1 68417.m01973 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein identical to pEARLI 1 (Accession No. L43080): an Arabidopsis member of a conserved gene family (PGF95-099), Plant Physiol. 109 (4), 1497 (1995); contains Pfam protease inhibitor/seed storage/LTP family domain PF00234 Length = 168 Score = 28.3 bits (60), Expect = 4.1 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +1 Query: 316 LPRRKAHPLPGRKENPLPRESARSPTLP 399 +P K P+P K P+P S SP++P Sbjct: 39 VPSPKPKPVPSPKPKPVPSPSVPSPSVP 66 >At1g31290.1 68414.m03829 PAZ domain-containing protein / piwi domain-containing protein contains Pfam profiles PF02170: PAZ domain, PF02171: Piwi domain Length = 1194 Score = 28.3 bits (60), Expect = 4.1 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = -2 Query: 397 VGLGNVHFHGVGDFLFYRVGDVLFDGVGN 311 VG+G+V GVGD VGDV DGVG+ Sbjct: 194 VGVGDVGQGGVGDVGQGGVGDVGRDGVGD 222 >At1g02840.3 68414.m00246 pre-mRNA splicing factor SF2 (SF2) / SR1 protein identical to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana} Length = 303 Score = 27.9 bits (59), Expect = 5.5 Identities = 19/62 (30%), Positives = 30/62 (48%), Gaps = 3/62 (4%) Frame = +1 Query: 337 PLPGRKENPLPRESARSPTLPRCQT---CPLPS*RDCQGTSSRTATLPSRKEGALPSTCP 507 P +P PR +RSP+ R ++ PLPS Q S++ + PS + + + P Sbjct: 245 PAKSTSRSPGPRSKSRSPSPRRSRSRSRSPLPS---VQKEGSKSPSKPSPAKSPIHTRSP 301 Query: 508 SR 513 SR Sbjct: 302 SR 303 >At1g02840.1 68414.m00245 pre-mRNA splicing factor SF2 (SF2) / SR1 protein identical to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana} Length = 303 Score = 27.9 bits (59), Expect = 5.5 Identities = 19/62 (30%), Positives = 30/62 (48%), Gaps = 3/62 (4%) Frame = +1 Query: 337 PLPGRKENPLPRESARSPTLPRCQT---CPLPS*RDCQGTSSRTATLPSRKEGALPSTCP 507 P +P PR +RSP+ R ++ PLPS Q S++ + PS + + + P Sbjct: 245 PAKSTSRSPGPRSKSRSPSPRRSRSRSRSPLPS---VQKEGSKSPSKPSPAKSPIHTRSP 301 Query: 508 SR 513 SR Sbjct: 302 SR 303 >At2g29210.1 68415.m03550 splicing factor PWI domain-containing protein contains Pfam profile PF01480: PWI domain Length = 878 Score = 27.5 bits (58), Expect = 7.2 Identities = 23/68 (33%), Positives = 34/68 (50%), Gaps = 1/68 (1%) Frame = +1 Query: 322 RRKAHPLPGRKENPLPRESARSPTLP-RCQTCPLPS*RDCQGTSSRTATLPSRKEGALPS 498 RR H GR+++P P RSP+ P R + P P R R+ + P+R+ + Sbjct: 293 RRPTHE--GRRQSPAPSRRRRSPSPPARRRRSPSPPAR-----RRRSPSPPARRHRS--P 343 Query: 499 TCPSRQTR 522 T P+RQ R Sbjct: 344 TPPARQRR 351 >At2g26670.1 68415.m03199 heme oxygenase 1 (HO1) (HY1) identical to plastid heme oxygenase (HY1) [Arabidopsis thaliana] GI:4877362, heme oxygenase 1 [Arabidopsis thaliana] GI:4530591 GB:AF132475; annotation updated per Seth J. Davis at University of Wisconsin-Madison Length = 282 Score = 27.5 bits (58), Expect = 7.2 Identities = 14/42 (33%), Positives = 25/42 (59%) Frame = +3 Query: 405 SNMSLTQLKRLSRYQFTYRNPTQSKRRCLTQYMSQSTDPSPS 530 S++S+ + +LSR+QF+ +P R Q +S + + SPS Sbjct: 9 SSLSIFKNPQLSRFQFSSSSPNPLFLRPRIQILSMTMNKSPS 50 >At4g24790.1 68417.m03550 expressed protein ; expression supported by MPSS Length = 815 Score = 27.1 bits (57), Expect = 9.6 Identities = 12/47 (25%), Positives = 21/47 (44%) Frame = +1 Query: 430 RDCQGTSSRTATLPSRKEGALPSTCPSRQTRPRQGICAXTLPPLKRK 570 R CQG R ++ S + +C S Q +C +PP +++ Sbjct: 769 RSCQGNVLRARSVRSSANASSRMSCSSDQGDATSAMCTPHIPPGEKR 815 >At1g62510.1 68414.m07053 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein contains Pfam protease inhibitor/seed storage/LTP family domain PF00234 Length = 149 Score = 27.1 bits (57), Expect = 9.6 Identities = 11/33 (33%), Positives = 14/33 (42%) Frame = +1 Query: 319 PRRKAHPLPGRKENPLPRESARSPTLPRCQTCP 417 P+ K P P K NP P+ + P CP Sbjct: 36 PKHKPSPSPKPKPNPKPKPTPHPSPSPAIAKCP 68 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,066,449 Number of Sequences: 28952 Number of extensions: 169556 Number of successful extensions: 543 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 503 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 538 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1197101088 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -