BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0619 (339 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_02_1213 + 27058329-27058370,27058634-27058711,27058807-270589... 49 1e-06 03_05_0601 + 26039326-26039367,26039958-26040035,26040136-260403... 47 4e-06 03_01_0365 - 2839190-2839251,2839637-2839694,2839946-2840032,284... 46 1e-05 10_08_0165 + 15356748-15356811,15357113-15357186,15357311-153573... 45 1e-05 05_03_0590 - 15884485-15884489,15884702-15884790,15885086-158852... 44 4e-05 07_03_1397 + 26269186-26269525,26269727-26269932,26270225-262703... 38 0.002 09_02_0222 + 5968232-5968467,5970811-5971187,5972216-5972256,597... 37 0.005 03_01_0326 + 2535800-2535938,2536891-2536959,2537310-2537375,253... 37 0.005 07_03_0473 - 18525712-18525858,18526049-18526162,18526442-185265... 36 0.008 05_06_0082 - 25425050-25425479,25426551-25426783 36 0.008 10_06_0181 - 11532765-11533203,11536867-11537036 36 0.011 08_02_1318 - 26111031-26111276,26112139-26112427,26112936-261130... 36 0.011 10_08_0250 - 16179646-16179759,16180197-16180325,16180519-161806... 35 0.014 01_06_0712 + 31397167-31397402,31399823-31400252 35 0.014 01_05_0340 - 21139885-21139978,21140169-21140272,21140379-211405... 35 0.014 09_02_0464 - 9591139-9591571,9592601-9592818 35 0.019 06_03_0414 - 20548577-20549006,20553521-20553744 35 0.019 05_07_0127 - 27872803-27873238,27873842-27874059 35 0.019 05_01_0037 - 256891-256998,257347-257502,257753-257824,258737-25... 35 0.019 05_01_0036 + 253734-253904,255216-255707 35 0.019 03_06_0637 - 35219212-35219754,35220405-35220587 34 0.025 03_06_0501 - 34380155-34380637,34380961-34381029,34382206-343822... 34 0.025 01_06_1343 - 36461476-36461961,36463355-36463519 34 0.025 01_06_0186 + 27294973-27295211,27295610-27296045 34 0.025 07_01_0926 - 7775536-7775616,7775695-7775787,7775903-7775965,777... 34 0.033 03_06_0475 + 34193951-34194023,34195414-34195486,34195572-341956... 34 0.033 02_05_0161 + 26384079-26384086,26386173-26386226,26386376-263864... 34 0.033 01_01_0565 - 4159946-4160042,4160140-4160243,4160378-4160533,416... 34 0.033 06_03_1387 - 29820358-29821035 33 0.043 05_03_0286 - 11623575-11624063,11625098-11625262 33 0.043 09_06_0029 + 20336634-20336881,20337737-20338208 33 0.057 10_03_0038 - 7297210-7297248,7297361-7297429,7297524-7297731,729... 32 0.100 03_01_0647 + 4745788-4745907,4746510-4746591,4746847-4746958,474... 32 0.13 06_03_0668 + 23301578-23301791,23302102-23302199,23302233-233023... 31 0.17 06_01_0462 - 3285667-3288123 31 0.23 10_01_0198 - 2158139-2158334,2158517-2158641,2158736-2158789,215... 31 0.30 05_07_0205 - 28402436-28402505,28402604-28402681,28402789-284029... 31 0.30 01_05_0673 + 24183512-24183514,24183625-24183694,24184203-241842... 31 0.30 07_03_0398 - 17690979-17690998,17691034-17691446,17691709-176917... 29 0.70 11_01_0389 - 2937242-2939476,2939556-2939666,2941254-2941450,294... 29 1.2 01_06_0930 + 33134385-33138257 28 1.6 01_01_0893 + 7043130-7043182,7043309-7043335,7043461-7043560,704... 28 1.6 08_02_0543 + 18391122-18391471,18391870-18392005,18393529-18393597 28 2.1 10_08_0442 + 17957358-17958075,17958156-17958242,17958547-179586... 27 2.8 06_01_0083 - 659510-661267,661577-662384,662700-663646 27 2.8 03_01_0180 + 1456182-1456359,1456444-1456520,1456570-1456692,145... 27 2.8 11_01_0127 + 1031690-1031952,1032850-1032857,1034679-1034927,103... 27 3.8 06_03_1075 + 27399279-27399376,27399449-27399555,27400791-274008... 27 3.8 01_06_0603 + 30530486-30530984,30531174-30531202,30531484-305316... 27 3.8 01_06_0523 - 30009191-30010531 27 3.8 08_02_1257 - 25646029-25646054,25646139-25646236,25646609-256467... 27 5.0 03_01_0316 + 2487917-2488003,2488104-2488676 27 5.0 01_06_0196 - 27410837-27413296 27 5.0 11_01_0746 + 6294277-6294687 26 6.6 07_03_0638 + 20196216-20196650,20196810-20196930,20197072-201971... 26 6.6 05_05_0118 - 22504483-22504566,22504650-22504742,22504852-225049... 26 6.6 03_06_0463 + 34121421-34121560,34121728-34121812,34122129-341224... 26 6.6 01_05_0109 + 18201344-18202811,18203234-18203883 26 6.6 08_02_1563 + 27886202-27886446,27886533-27886618,27886942-278870... 26 8.7 07_03_1552 - 27648193-27648307,27648384-27648431,27649140-276492... 26 8.7 03_05_0989 + 29483281-29484612 26 8.7 01_07_0232 + 42182942-42183490,42183593-42183661,42184320-421844... 26 8.7 01_06_0639 + 30772804-30772904,30773386-30775675 26 8.7 >12_02_1213 + 27058329-27058370,27058634-27058711,27058807-27058974, 27059834-27059882,27060084-27060157,27060692-27060785, 27060924-27061003,27061311-27061322 Length = 198 Score = 48.8 bits (111), Expect = 1e-06 Identities = 25/37 (67%), Positives = 26/37 (70%) Frame = +3 Query: 228 PQTKVCQFKLVLLGQSAVGKSSLVLRFVKGQFHESQE 338 P K+ KLVLLG GKSSLVLRFVKGQF E QE Sbjct: 5 PGNKIRNAKLVLLGDVGTGKSSLVLRFVKGQFVEFQE 41 >03_05_0601 + 26039326-26039367,26039958-26040035,26040136-26040303, 26040994-26041042,26041502-26041575,26041940-26041948 Length = 139 Score = 46.8 bits (106), Expect = 4e-06 Identities = 24/34 (70%), Positives = 25/34 (73%) Frame = +3 Query: 237 KVCQFKLVLLGQSAVGKSSLVLRFVKGQFHESQE 338 K+ KLVLLG GKSSLVLRFVKGQF E QE Sbjct: 8 KIRNAKLVLLGDVGAGKSSLVLRFVKGQFVEFQE 41 >03_01_0365 - 2839190-2839251,2839637-2839694,2839946-2840032, 2840117-2840206,2840575-2840650,2840877-2840971, 2841090-2841173,2841270-2841343,2841803-2841827 Length = 216 Score = 45.6 bits (103), Expect = 1e-05 Identities = 22/35 (62%), Positives = 26/35 (74%) Frame = +3 Query: 219 NGAPQTKVCQFKLVLLGQSAVGKSSLVLRFVKGQF 323 N A +K + KLVLLG S VGKS +VLRFV+GQF Sbjct: 22 NSATDSKDLRAKLVLLGDSGVGKSCIVLRFVRGQF 56 >10_08_0165 + 15356748-15356811,15357113-15357186,15357311-15357394, 15357508-15357602,15357737-15357790,15357791-15357896, 15358236-15358277,15358585-15358674,15358788-15358984, 15359355-15359413,15360166-15362252 Length = 983 Score = 45.2 bits (102), Expect = 1e-05 Identities = 22/41 (53%), Positives = 25/41 (60%) Frame = +3 Query: 201 GAAQRPNGAPQTKVCQFKLVLLGQSAVGKSSLVLRFVKGQF 323 G N K + KLVLLG S VGKS +VLRFV+GQF Sbjct: 29 GTISNENSGTDLKNLRVKLVLLGDSGVGKSCIVLRFVRGQF 69 >05_03_0590 - 15884485-15884489,15884702-15884790,15885086-15885251, 15885333-15885393,15886256-15886392,15887936-15888002 Length = 174 Score = 43.6 bits (98), Expect = 4e-05 Identities = 23/42 (54%), Positives = 27/42 (64%) Frame = +3 Query: 213 RPNGAPQTKVCQFKLVLLGQSAVGKSSLVLRFVKGQFHESQE 338 +P PQ V FKLVLLG VGK+SLVLR+V F + QE Sbjct: 4 KPPPPPQPSV-SFKLVLLGDGRVGKTSLVLRYVNDVFSDKQE 44 >07_03_1397 + 26269186-26269525,26269727-26269932,26270225-26270327, 26270570-26270577 Length = 218 Score = 37.9 bits (84), Expect = 0.002 Identities = 15/30 (50%), Positives = 24/30 (80%) Frame = +3 Query: 249 FKLVLLGQSAVGKSSLVLRFVKGQFHESQE 338 FK+VLLG S+VGKS+L+ RF + +F+ + + Sbjct: 15 FKIVLLGDSSVGKSNLLARFARNEFYPNSK 44 >09_02_0222 + 5968232-5968467,5970811-5971187,5972216-5972256, 5972808-5972843 Length = 229 Score = 36.7 bits (81), Expect = 0.005 Identities = 15/26 (57%), Positives = 21/26 (80%) Frame = +3 Query: 249 FKLVLLGQSAVGKSSLVLRFVKGQFH 326 FK+VL+G SAVGKS L+ RF + +F+ Sbjct: 19 FKVVLIGDSAVGKSQLLARFARNEFN 44 >03_01_0326 + 2535800-2535938,2536891-2536959,2537310-2537375, 2537979-2538100,2538501-2538629,2540462-2540569 Length = 210 Score = 36.7 bits (81), Expect = 0.005 Identities = 15/23 (65%), Positives = 20/23 (86%) Frame = +3 Query: 243 CQFKLVLLGQSAVGKSSLVLRFV 311 C FK++L+G SAVGKSSL++ FV Sbjct: 11 CSFKILLIGDSAVGKSSLLVSFV 33 >07_03_0473 - 18525712-18525858,18526049-18526162,18526442-18526522, 18526787-18526865,18526902-18526996,18527092-18527170, 18527339-18527450,18527682-18527770,18527868-18527938, 18528846-18528962 Length = 327 Score = 35.9 bits (79), Expect = 0.008 Identities = 14/38 (36%), Positives = 26/38 (68%) Frame = +3 Query: 225 APQTKVCQFKLVLLGQSAVGKSSLVLRFVKGQFHESQE 338 AP + + ++KLV LG +VGK+S++ RF+ +F + + Sbjct: 2 APVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDNTYQ 39 >05_06_0082 - 25425050-25425479,25426551-25426783 Length = 220 Score = 35.9 bits (79), Expect = 0.008 Identities = 15/25 (60%), Positives = 20/25 (80%) Frame = +3 Query: 249 FKLVLLGQSAVGKSSLVLRFVKGQF 323 FK+VL+G S VGKS+L+ RF K +F Sbjct: 18 FKVVLIGDSGVGKSNLLSRFTKNEF 42 >10_06_0181 - 11532765-11533203,11536867-11537036 Length = 202 Score = 35.5 bits (78), Expect = 0.011 Identities = 14/25 (56%), Positives = 20/25 (80%) Frame = +3 Query: 249 FKLVLLGQSAVGKSSLVLRFVKGQF 323 FK+VL+G SAVGKS ++ RF + +F Sbjct: 11 FKVVLIGDSAVGKSQILARFARNEF 35 >08_02_1318 - 26111031-26111276,26112139-26112427,26112936-26113036, 26113628-26113878,26114842-26114865,26115793-26116129 Length = 415 Score = 35.5 bits (78), Expect = 0.011 Identities = 14/32 (43%), Positives = 25/32 (78%) Frame = +3 Query: 231 QTKVCQFKLVLLGQSAVGKSSLVLRFVKGQFH 326 +T+ FK+V++G SAVGKS+L+ R+ + +F+ Sbjct: 8 ETEEYLFKVVIIGDSAVGKSNLLSRYARNEFN 39 >10_08_0250 - 16179646-16179759,16180197-16180325,16180519-16180640, 16181073-16181138,16182202-16182270,16182989-16183157 Length = 222 Score = 35.1 bits (77), Expect = 0.014 Identities = 14/23 (60%), Positives = 19/23 (82%) Frame = +3 Query: 243 CQFKLVLLGQSAVGKSSLVLRFV 311 C FK++L+G S VGKSSL++ FV Sbjct: 18 CSFKILLIGDSGVGKSSLLVSFV 40 >01_06_0712 + 31397167-31397402,31399823-31400252 Length = 221 Score = 35.1 bits (77), Expect = 0.014 Identities = 15/25 (60%), Positives = 19/25 (76%) Frame = +3 Query: 249 FKLVLLGQSAVGKSSLVLRFVKGQF 323 FK VL+G S VGKS+L+ RF K +F Sbjct: 19 FKTVLIGDSGVGKSNLLSRFTKNEF 43 >01_05_0340 - 21139885-21139978,21140169-21140272,21140379-21140534, 21140622-21140693,21140782-21140829,21140923-21140970, 21141807-21141879,21142333-21142346 Length = 202 Score = 35.1 bits (77), Expect = 0.014 Identities = 16/28 (57%), Positives = 20/28 (71%) Frame = +3 Query: 249 FKLVLLGQSAVGKSSLVLRFVKGQFHES 332 FKL+L+G S VGKS L+LRF + ES Sbjct: 9 FKLLLIGDSGVGKSCLLLRFADDSYLES 36 >09_02_0464 - 9591139-9591571,9592601-9592818 Length = 216 Score = 34.7 bits (76), Expect = 0.019 Identities = 14/25 (56%), Positives = 20/25 (80%) Frame = +3 Query: 249 FKLVLLGQSAVGKSSLVLRFVKGQF 323 FK+VL+G S VGKS+L+ RF + +F Sbjct: 13 FKVVLIGDSGVGKSNLLSRFTRNEF 37 >06_03_0414 - 20548577-20549006,20553521-20553744 Length = 217 Score = 34.7 bits (76), Expect = 0.019 Identities = 14/25 (56%), Positives = 20/25 (80%) Frame = +3 Query: 249 FKLVLLGQSAVGKSSLVLRFVKGQF 323 FK+VL+G S VGKS+L+ RF + +F Sbjct: 15 FKVVLIGDSGVGKSNLLSRFTRNEF 39 >05_07_0127 - 27872803-27873238,27873842-27874059 Length = 217 Score = 34.7 bits (76), Expect = 0.019 Identities = 14/25 (56%), Positives = 20/25 (80%) Frame = +3 Query: 249 FKLVLLGQSAVGKSSLVLRFVKGQF 323 FK+VL+G S VGKS+L+ RF + +F Sbjct: 13 FKVVLIGDSGVGKSNLLSRFTRNEF 37 >05_01_0037 - 256891-256998,257347-257502,257753-257824,258737-258784, 259071-259143,259237-259250 Length = 156 Score = 34.7 bits (76), Expect = 0.019 Identities = 15/22 (68%), Positives = 19/22 (86%) Frame = +3 Query: 249 FKLVLLGQSAVGKSSLVLRFVK 314 FKL+L+G S+VGKS L+LRF K Sbjct: 9 FKLLLIGDSSVGKSCLLLRFAK 30 >05_01_0036 + 253734-253904,255216-255707 Length = 220 Score = 34.7 bits (76), Expect = 0.019 Identities = 14/25 (56%), Positives = 20/25 (80%) Frame = +3 Query: 249 FKLVLLGQSAVGKSSLVLRFVKGQF 323 FK+VL+G S VGKS+L+ RF + +F Sbjct: 15 FKVVLIGDSGVGKSNLLSRFTRNEF 39 >03_06_0637 - 35219212-35219754,35220405-35220587 Length = 241 Score = 34.3 bits (75), Expect = 0.025 Identities = 14/25 (56%), Positives = 19/25 (76%) Frame = +3 Query: 249 FKLVLLGQSAVGKSSLVLRFVKGQF 323 FK+VL+G S VGKS+L+ RF + F Sbjct: 19 FKIVLIGDSGVGKSNLLSRFTRNSF 43 >03_06_0501 - 34380155-34380637,34380961-34381029,34382206-34382229, 34382622-34382786 Length = 246 Score = 34.3 bits (75), Expect = 0.025 Identities = 13/25 (52%), Positives = 20/25 (80%) Frame = +3 Query: 249 FKLVLLGQSAVGKSSLVLRFVKGQF 323 FK+VL+G S VGKS+++ RF + +F Sbjct: 13 FKIVLIGDSGVGKSNILSRFTRNEF 37 >01_06_1343 - 36461476-36461961,36463355-36463519 Length = 216 Score = 34.3 bits (75), Expect = 0.025 Identities = 13/25 (52%), Positives = 20/25 (80%) Frame = +3 Query: 249 FKLVLLGQSAVGKSSLVLRFVKGQF 323 FK+VL+G S VGKS+++ RF + +F Sbjct: 13 FKIVLIGDSGVGKSNILSRFTRNEF 37 >01_06_0186 + 27294973-27295211,27295610-27296045 Length = 224 Score = 34.3 bits (75), Expect = 0.025 Identities = 14/25 (56%), Positives = 20/25 (80%) Frame = +3 Query: 249 FKLVLLGQSAVGKSSLVLRFVKGQF 323 FK+VL+G S VGKS+L+ RF + +F Sbjct: 20 FKVVLIGDSGVGKSNLLSRFARDEF 44 >07_01_0926 - 7775536-7775616,7775695-7775787,7775903-7775965, 7776326-7776423,7776661-7776761,7776865-7776937, 7778575-7778647 Length = 193 Score = 33.9 bits (74), Expect = 0.033 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +3 Query: 252 KLVLLGQSAVGKSSLVLRFVKGQFHES 332 KL+L+G S VGKS L+LRF G F S Sbjct: 17 KLLLIGDSGVGKSCLLLRFSDGSFTTS 43 >03_06_0475 + 34193951-34194023,34195414-34195486,34195572-34195672, 34195912-34196009,34196326-34196388,34196534-34196626, 34196697-34196774 Length = 192 Score = 33.9 bits (74), Expect = 0.033 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +3 Query: 252 KLVLLGQSAVGKSSLVLRFVKGQFHES 332 KL+L+G S VGKS L+LRF G F S Sbjct: 17 KLLLIGDSGVGKSCLLLRFSDGSFTTS 43 >02_05_0161 + 26384079-26384086,26386173-26386226,26386376-26386448, 26386775-26386822,26386906-26386953,26387990-26388061, 26388156-26388311,26388428-26388531,26388628-26388724 Length = 219 Score = 33.9 bits (74), Expect = 0.033 Identities = 15/28 (53%), Positives = 20/28 (71%) Frame = +3 Query: 249 FKLVLLGQSAVGKSSLVLRFVKGQFHES 332 FKL+L+G S VGKS L+LRF + +S Sbjct: 25 FKLLLIGDSGVGKSCLLLRFADDSYLDS 52 >01_01_0565 - 4159946-4160042,4160140-4160243,4160378-4160533, 4160629-4160700,4161796-4161843,4161923-4161970, 4162295-4162367,4163188-4163201 Length = 203 Score = 33.9 bits (74), Expect = 0.033 Identities = 15/28 (53%), Positives = 20/28 (71%) Frame = +3 Query: 249 FKLVLLGQSAVGKSSLVLRFVKGQFHES 332 FKL+L+G S VGKS L+LRF + +S Sbjct: 9 FKLLLIGDSGVGKSCLLLRFADDSYLDS 36 >06_03_1387 - 29820358-29821035 Length = 225 Score = 33.5 bits (73), Expect = 0.043 Identities = 14/25 (56%), Positives = 20/25 (80%) Frame = +3 Query: 249 FKLVLLGQSAVGKSSLVLRFVKGQF 323 FK+V++G SAVGK+ L+ RF K +F Sbjct: 8 FKVVVIGDSAVGKTQLLGRFTKDEF 32 >05_03_0286 - 11623575-11624063,11625098-11625262 Length = 217 Score = 33.5 bits (73), Expect = 0.043 Identities = 13/25 (52%), Positives = 19/25 (76%) Frame = +3 Query: 249 FKLVLLGQSAVGKSSLVLRFVKGQF 323 FK+VL+G S VGKS+++ RF + F Sbjct: 13 FKMVLIGDSGVGKSNILSRFTRNHF 37 >09_06_0029 + 20336634-20336881,20337737-20338208 Length = 239 Score = 33.1 bits (72), Expect = 0.057 Identities = 14/25 (56%), Positives = 20/25 (80%) Frame = +3 Query: 249 FKLVLLGQSAVGKSSLVLRFVKGQF 323 FK+V++G SAVGK+ L+ RF K +F Sbjct: 23 FKVVVVGDSAVGKTQLLGRFTKDEF 47 >10_03_0038 - 7297210-7297248,7297361-7297429,7297524-7297731, 7297829-7297911,7298859-7298998,7299132-7299183 Length = 196 Score = 32.3 bits (70), Expect = 0.100 Identities = 14/35 (40%), Positives = 22/35 (62%) Frame = +3 Query: 234 TKVCQFKLVLLGQSAVGKSSLVLRFVKGQFHESQE 338 T +FK V +G + VGKS L+L+F +F E ++ Sbjct: 4 TYAYRFKFVTIGDAGVGKSCLLLQFTDKRFREVED 38 >03_01_0647 + 4745788-4745907,4746510-4746591,4746847-4746958, 4747607-4747697,4747805-4747969 Length = 189 Score = 31.9 bits (69), Expect = 0.13 Identities = 12/28 (42%), Positives = 21/28 (75%) Frame = +3 Query: 240 VCQFKLVLLGQSAVGKSSLVLRFVKGQF 323 + ++KLV LG AVGK++++ RF+ +F Sbjct: 8 LAKYKLVFLGDQAVGKTAIITRFMYDKF 35 >06_03_0668 + 23301578-23301791,23302102-23302199,23302233-23302301, 23302674-23302961,23303045-23303208,23303344-23303599, 23303706-23303816,23304109-23304195,23305916-23305985, 23306093-23306149,23306309-23306426,23307314-23307403, 23307492-23307671,23307816-23307893,23308016-23308088 Length = 650 Score = 31.5 bits (68), Expect = 0.17 Identities = 12/30 (40%), Positives = 19/30 (63%) Frame = +3 Query: 249 FKLVLLGQSAVGKSSLVLRFVKGQFHESQE 338 FKL+L+G GK++ V R + G+F + E Sbjct: 442 FKLILVGDGGTGKTTFVKRHITGEFEKRYE 471 >06_01_0462 - 3285667-3288123 Length = 818 Score = 31.1 bits (67), Expect = 0.23 Identities = 12/32 (37%), Positives = 19/32 (59%) Frame = -2 Query: 212 LCGSGPVCRHIPPCHCSSVLNFFLGDRSSRSR 117 +CG+ VC +IP HCS + F + D + S+ Sbjct: 303 VCGTNAVCNYIPELHCSCLQGFEVIDPTDWSK 334 >10_01_0198 - 2158139-2158334,2158517-2158641,2158736-2158789, 2159038-2159342,2159677-2159860,2159908-2159999, 2161777-2161885 Length = 354 Score = 30.7 bits (66), Expect = 0.30 Identities = 18/47 (38%), Positives = 26/47 (55%) Frame = +3 Query: 177 RDMATNRTGAAQRPNGAPQTKVCQFKLVLLGQSAVGKSSLVLRFVKG 317 RD +G + NG T Q +++++G S VGKSSLV +KG Sbjct: 5 RDSGGGGSGGGRDLNGGG-TPCGQVRVLVVGDSGVGKSSLVHLILKG 50 >05_07_0205 - 28402436-28402505,28402604-28402681,28402789-28402968, 28403051-28403140,28403258-28403375,28403461-28403517, 28404155-28404224,28404317-28404319 Length = 221 Score = 30.7 bits (66), Expect = 0.30 Identities = 12/30 (40%), Positives = 19/30 (63%) Frame = +3 Query: 249 FKLVLLGQSAVGKSSLVLRFVKGQFHESQE 338 FKLV++G GK++ V R + G+F + E Sbjct: 14 FKLVIVGDGGTGKTTFVKRHLTGEFEKKYE 43 >01_05_0673 + 24183512-24183514,24183625-24183694,24184203-24184259, 24184348-24184465,24185044-24185133,24185209-24185388, 24185474-24185551,24185642-24185711 Length = 221 Score = 30.7 bits (66), Expect = 0.30 Identities = 12/30 (40%), Positives = 19/30 (63%) Frame = +3 Query: 249 FKLVLLGQSAVGKSSLVLRFVKGQFHESQE 338 FKLV++G GK++ V R + G+F + E Sbjct: 14 FKLVIVGDGGTGKTTFVKRHLTGEFEKKYE 43 >07_03_0398 - 17690979-17690998,17691034-17691446,17691709-17691764, 17691922-17692054,17694244-17694403,17694862-17694955, 17695791-17695928,17696017-17696174,17696729-17696810, 17697055-17697151,17698703-17698824,17699833-17699910, 17700437-17700565,17701301-17701531 Length = 636 Score = 29.5 bits (63), Expect = 0.70 Identities = 16/48 (33%), Positives = 25/48 (52%) Frame = -2 Query: 149 FFLGDRSSRSRRDTEIIINYTLKQI*SLIVNVKLENLEQKSKMTTNKH 6 FF+ SS +R+ E IINY L ++ + +LE L T +K+ Sbjct: 123 FFVQLTSSETRKVLEHIINYVLYKMFQSLARERLEQLNASPSATPSKY 170 >11_01_0389 - 2937242-2939476,2939556-2939666,2941254-2941450, 2941543-2941633 Length = 877 Score = 28.7 bits (61), Expect = 1.2 Identities = 14/45 (31%), Positives = 22/45 (48%) Frame = +1 Query: 103 ISVSRRLREDLSPKKKFRTELQ*QGGIWRQTGPEPHRGPMALHRQ 237 + S ++ +D+ T+ G+ QT PEPH MALH + Sbjct: 437 VGCSDKVNQDIQDDGNIMTKNMVCDGLNVQTAPEPHSCRMALHNK 481 >01_06_0930 + 33134385-33138257 Length = 1290 Score = 28.3 bits (60), Expect = 1.6 Identities = 16/57 (28%), Positives = 27/57 (47%), Gaps = 3/57 (5%) Frame = -2 Query: 287 LAYRRLAQQHQLELADFCLWSAIGP---LCGSGPVCRHIPPCHCSSVLNFFLGDRSS 126 L R A+ Q+ L C+++ + CG P +I C C S + ++GD +S Sbjct: 1063 LQLARGAEFMQMSLEKLCVYNCVLSADFFCGDWPHLNNIGLCGCRSSASLYVGDLTS 1119 >01_01_0893 + 7043130-7043182,7043309-7043335,7043461-7043560, 7045110-7045256,7045342-7045422,7045509-7045654, 7046030-7046099 Length = 207 Score = 28.3 bits (60), Expect = 1.6 Identities = 11/24 (45%), Positives = 19/24 (79%) Frame = +3 Query: 252 KLVLLGQSAVGKSSLVLRFVKGQF 323 K+++LG S VGK+SL+ ++V +F Sbjct: 10 KVIILGDSGVGKTSLMNQYVNKKF 33 >08_02_0543 + 18391122-18391471,18391870-18392005,18393529-18393597 Length = 184 Score = 27.9 bits (59), Expect = 2.1 Identities = 14/37 (37%), Positives = 19/37 (51%) Frame = +2 Query: 224 RSTDKSLPVQAGVVGPVCGRQVLPGAPIRQGTVPRVP 334 +ST+ S P GPV R L AP+R+ P +P Sbjct: 33 QSTESSCPDDPSTPGPVARRGDLFAAPLRRWPRPLIP 69 >10_08_0442 + 17957358-17958075,17958156-17958242,17958547-17958647, 17958766-17958834,17958989-17959156 Length = 380 Score = 27.5 bits (58), Expect = 2.8 Identities = 15/34 (44%), Positives = 19/34 (55%) Frame = +2 Query: 143 RKSSERSYSDREGYGDKQDRSRTEAQWRSTDKSL 244 R+S +Y DR DRSR + WR+ DKSL Sbjct: 92 RESRSDTYYDRTKRDGTSDRSRGD--WRNDDKSL 123 >06_01_0083 - 659510-661267,661577-662384,662700-663646 Length = 1170 Score = 27.5 bits (58), Expect = 2.8 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = +2 Query: 179 GYGDKQDRSRTEAQWRSTDKSLPVQAGVVGP 271 G GD Q T WR + L + AGV+ P Sbjct: 284 GGGDGQPAEFTSKPWRPLTRKLKIPAGVLSP 314 >03_01_0180 + 1456182-1456359,1456444-1456520,1456570-1456692, 1456783-1456896,1457580-1457666,1458040-1458179, 1458253-1458340,1459125-1459198,1461147-1461340, 1461430-1461632,1461955-1462001,1462084-1462336, 1462551-1462568 Length = 531 Score = 27.5 bits (58), Expect = 2.8 Identities = 16/49 (32%), Positives = 22/49 (44%), Gaps = 2/49 (4%) Frame = +2 Query: 128 KICRPRKSSERSYSDREGYGDKQDRSRTEAQWRS--TDKSLPVQAGVVG 268 +I P S E++YSDR Y DRS + R D P + + G Sbjct: 321 RIKEPGASIEKTYSDRSDYKTNSDRSDYKINHRDAHADGLSPSRVSIAG 369 >11_01_0127 + 1031690-1031952,1032850-1032857,1034679-1034927, 1034938-1035009,1036609-1036724,1037482-1037545, 1037742-1037773,1037804-1037850,1038627-1038660, 1039308-1039652,1040425-1040718,1040968-1041232, 1041359-1041480,1041754-1042059 Length = 738 Score = 27.1 bits (57), Expect = 3.8 Identities = 13/43 (30%), Positives = 20/43 (46%) Frame = +2 Query: 185 GDKQDRSRTEAQWRSTDKSLPVQAGVVGPVCGRQVLPGAPIRQ 313 G K+ RT+ W S ++ G VG V R V+ P ++ Sbjct: 629 GTKRQLVRTDRGWSSAQRARRFATGSVGGVIKRMVITALPAQR 671 >06_03_1075 + 27399279-27399376,27399449-27399555,27400791-27400898, 27401763-27401860,27401983-27402033,27402137-27402228, 27402360-27402459,27402765-27402884,27402977-27403045, 27403299-27403345,27403428-27403483,27404760-27404800, 27405155-27405260,27406728-27406860,27406937-27407357 Length = 548 Score = 27.1 bits (57), Expect = 3.8 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = +2 Query: 113 HGDFVKICRPRKSSERSYSDREGYGDKQDRSR 208 H D+ + C+P + S + DR GY + RS+ Sbjct: 476 HEDYNRYCKPGERSSSRHDDR-GYSKHESRSK 506 >01_06_0603 + 30530486-30530984,30531174-30531202,30531484-30531660, 30533662-30533745,30534059-30534277 Length = 335 Score = 27.1 bits (57), Expect = 3.8 Identities = 16/44 (36%), Positives = 27/44 (61%) Frame = +3 Query: 183 MATNRTGAAQRPNGAPQTKVCQFKLVLLGQSAVGKSSLVLRFVK 314 +A + ++ RP+ P+ + +F LV G+S VGKSSL+ V+ Sbjct: 114 IAADFVKSSVRPDDCPRDGLPEFALV--GRSNVGKSSLLNSLVR 155 >01_06_0523 - 30009191-30010531 Length = 446 Score = 27.1 bits (57), Expect = 3.8 Identities = 13/40 (32%), Positives = 21/40 (52%) Frame = -2 Query: 206 GSGPVCRHIPPCHCSSVLNFFLGDRSSRSRRDTEIIINYT 87 G + + P + SV + LGDR+SRS R + ++ T Sbjct: 220 GKISISTQVAPAY-GSVFEYCLGDRTSRSTRSSYLVFGRT 258 >08_02_1257 - 25646029-25646054,25646139-25646236,25646609-25646700, 25646786-25646893,25647212-25647346,25647648-25647752, 25647951-25648088,25648865-25648963,25649079-25649195, 25649446-25649610,25649955-25650014,25650395-25650559, 25650636-25650746,25651220-25651333,25651466-25651531, 25651857-25651994,25652303-25652386,25652468-25652510, 25652621-25652676,25652772-25652880,25652944-25653026, 25653127-25653210,25653383-25653454,25653557-25653634, 25653717-25653800,25653892-25653962,25654095-25654164, 25654314-25654403,25654500-25654661,25654702-25654817, 25654946-25654988,25655069-25655185,25655897-25656046 Length = 1082 Score = 26.6 bits (56), Expect = 5.0 Identities = 9/32 (28%), Positives = 19/32 (59%) Frame = -3 Query: 253 LNWQTFVCGAPLGLCAAPVLFVAISLPVTVAP 158 LNW+ ++ +G+ + P+ ++ +PV V P Sbjct: 1027 LNWRLWLVSVAIGIISWPLAYLGKFIPVPVRP 1058 >03_01_0316 + 2487917-2488003,2488104-2488676 Length = 219 Score = 26.6 bits (56), Expect = 5.0 Identities = 15/53 (28%), Positives = 19/53 (35%) Frame = +2 Query: 179 GYGDKQDRSRTEAQWRSTDKSLPVQAGVVGPVCGRQVLPGAPIRQGTVPRVPG 337 G G + E +W S + P + V PGAP R PR G Sbjct: 37 GEGQGEGEEEEELEWLSNKDAFPSVDTMAAEV--ESAAPGAPARAAVGPRTKG 87 >01_06_0196 - 27410837-27413296 Length = 819 Score = 26.6 bits (56), Expect = 5.0 Identities = 9/27 (33%), Positives = 15/27 (55%) Frame = -2 Query: 212 LCGSGPVCRHIPPCHCSSVLNFFLGDR 132 LCG +C ++P CS + + + DR Sbjct: 288 LCGKNGLCEYLPSLRCSCLPGYEMVDR 314 >11_01_0746 + 6294277-6294687 Length = 136 Score = 26.2 bits (55), Expect = 6.6 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +3 Query: 159 GATVTGRDMATNRTGAAQRPNG 224 G TG + A +R+GA+ RP G Sbjct: 59 GGNSTGEEAARSRSGASSRPTG 80 >07_03_0638 + 20196216-20196650,20196810-20196930,20197072-20197168, 20197284-20197323,20197648-20197731,20198966-20199130 Length = 313 Score = 26.2 bits (55), Expect = 6.6 Identities = 15/54 (27%), Positives = 26/54 (48%) Frame = +3 Query: 150 VQNGATVTGRDMATNRTGAAQRPNGAPQTKVCQFKLVLLGQSAVGKSSLVLRFV 311 V GA ++ + AA + A V K+ LLG +GK+S ++++V Sbjct: 96 VAAGAVLSPLPRDADDDAAAADRDAADVEDVVSLKVSLLGDCQIGKTSFMVKYV 149 >05_05_0118 - 22504483-22504566,22504650-22504742,22504852-22504914, 22505048-22505145,22505378-22505478,22505581-22505653, 22505872-22505910,22506946-22507018 Length = 207 Score = 26.2 bits (55), Expect = 6.6 Identities = 14/26 (53%), Positives = 15/26 (57%) Frame = +3 Query: 255 LVLLGQSAVGKSSLVLRFVKGQFHES 332 LVL VGKS L+LRF G F S Sbjct: 31 LVLSSIQCVGKSCLLLRFSDGSFTTS 56 >03_06_0463 + 34121421-34121560,34121728-34121812,34122129-34122428, 34123194-34123352,34123852-34123992,34124078-34124134, 34124534-34124672,34124954-34125058,34125159-34125376, 34125980-34126021,34126136-34126309 Length = 519 Score = 26.2 bits (55), Expect = 6.6 Identities = 14/33 (42%), Positives = 16/33 (48%) Frame = -2 Query: 212 LCGSGPVCRHIPPCHCSSVLNFFLGDRSSRSRR 114 LC PV R P S + NFFLG S + R Sbjct: 477 LCKIRPVAREEPSSFSSRMSNFFLGLFSQKGYR 509 >01_05_0109 + 18201344-18202811,18203234-18203883 Length = 705 Score = 26.2 bits (55), Expect = 6.6 Identities = 15/38 (39%), Positives = 19/38 (50%), Gaps = 3/38 (7%) Frame = -3 Query: 277 ADWPNNTSLN---WQTFVCGAPLGLCAAPVLFVAISLP 173 ADW +T+ + W CGA G A VA+SLP Sbjct: 41 ADWDASTAADPCAWNGVSCGAGSGAGGADRRVVALSLP 78 >08_02_1563 + 27886202-27886446,27886533-27886618,27886942-27887030, 27887193-27887432,27887527-27887648,27888103-27888178, 27888276-27888383,27888465-27888641,27888959-27889176, 27889313-27889445,27889584-27889807,27890052-27890205, 27890297-27890380 Length = 651 Score = 25.8 bits (54), Expect = 8.7 Identities = 13/28 (46%), Positives = 15/28 (53%) Frame = -1 Query: 93 LHT*TNIIINRKCKTGKSRTEIQNDHEQ 10 L T TN+ KCKT S E+ ND Q Sbjct: 266 LKTDTNLFEIAKCKTSVSAIEMSNDGTQ 293 >07_03_1552 - 27648193-27648307,27648384-27648431,27649140-27649234, 27649311-27649376,27649721-27649810,27650210-27650437, 27650572-27650605,27651106-27651611 Length = 393 Score = 25.8 bits (54), Expect = 8.7 Identities = 17/47 (36%), Positives = 21/47 (44%) Frame = -3 Query: 313 LTNRSTREDLPTADWPNNTSLNWQTFVCGAPLGLCAAPVLFVAISLP 173 +++ + ED A W L WQ FVCGA L P A LP Sbjct: 72 MSSSAAAEDGEAAYW-----LRWQVFVCGA---LIVLPTAAAAALLP 110 >03_05_0989 + 29483281-29484612 Length = 443 Score = 25.8 bits (54), Expect = 8.7 Identities = 14/37 (37%), Positives = 23/37 (62%) Frame = +2 Query: 206 RTEAQWRSTDKSLPVQAGVVGPVCGRQVLPGAPIRQG 316 R E WR+TD+S P+ G + PV +++ P+R+G Sbjct: 406 RFERMWRNTDESRPL--GDIFPV---EMMVWPPVRRG 437 >01_07_0232 + 42182942-42183490,42183593-42183661,42184320-42184451, 42184547-42184600,42184714-42184758,42185383-42185522, 42185777-42185902,42185985-42186002,42186631-42187276, 42188121-42188843 Length = 833 Score = 25.8 bits (54), Expect = 8.7 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = -2 Query: 272 LAQQHQLELADFCLWSAIGPLCGSGPVCR 186 +A+ E D C WSA+ LC PVCR Sbjct: 574 MARARAAEPPDQCGWSAVVQLC---PVCR 599 >01_06_0639 + 30772804-30772904,30773386-30775675 Length = 796 Score = 25.8 bits (54), Expect = 8.7 Identities = 14/37 (37%), Positives = 19/37 (51%) Frame = +2 Query: 149 SSERSYSDREGYGDKQDRSRTEAQWRSTDKSLPVQAG 259 SS R + GY D+Q AQ+RS + + P Q G Sbjct: 134 SSARVNNGASGYNDRQPYGSANAQYRS-NSAQPSQTG 169 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,413,439 Number of Sequences: 37544 Number of extensions: 186613 Number of successful extensions: 701 Number of sequences better than 10.0: 63 Number of HSP's better than 10.0 without gapping: 689 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 701 length of database: 14,793,348 effective HSP length: 73 effective length of database: 12,052,636 effective search space used: 470052804 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -