BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0619 (339 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_50855| Best HMM Match : Ras (HMM E-Value=0) 87 3e-18 SB_27557| Best HMM Match : Ras (HMM E-Value=0) 41 2e-04 SB_8853| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.002 SB_7589| Best HMM Match : Ras (HMM E-Value=0) 38 0.003 SB_47462| Best HMM Match : Ras (HMM E-Value=0) 37 0.005 SB_42246| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.005 SB_1071| Best HMM Match : Ras (HMM E-Value=0) 37 0.005 SB_52002| Best HMM Match : Ras (HMM E-Value=2.3e-19) 36 0.008 SB_4971| Best HMM Match : Ras (HMM E-Value=0) 36 0.011 SB_29253| Best HMM Match : Ras (HMM E-Value=2.8e-05) 35 0.015 SB_13045| Best HMM Match : Ras (HMM E-Value=0) 35 0.015 SB_45967| Best HMM Match : Ras (HMM E-Value=2.1e-07) 34 0.026 SB_34024| Best HMM Match : VLPT (HMM E-Value=3.7) 34 0.034 SB_24842| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.045 SB_12762| Best HMM Match : Ras (HMM E-Value=2.2e-21) 33 0.045 SB_17958| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.059 SB_22342| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.10 SB_6223| Best HMM Match : Ras (HMM E-Value=0) 32 0.10 SB_45519| Best HMM Match : RNB (HMM E-Value=1.6e-35) 32 0.10 SB_32061| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.14 SB_24843| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.18 SB_33745| Best HMM Match : Ras (HMM E-Value=2.5e-21) 31 0.18 SB_31418| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.18 SB_59261| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.32 SB_58218| Best HMM Match : Ras (HMM E-Value=1.4013e-44) 30 0.42 SB_56256| Best HMM Match : Ras (HMM E-Value=8.9e-31) 30 0.42 SB_37884| Best HMM Match : Ubie_methyltran (HMM E-Value=0.00014) 30 0.42 SB_45581| Best HMM Match : Ras (HMM E-Value=0.069) 30 0.42 SB_28695| Best HMM Match : Ras (HMM E-Value=0) 30 0.42 SB_36483| Best HMM Match : Ras (HMM E-Value=0) 30 0.55 SB_3743| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.55 SB_39378| Best HMM Match : VWA (HMM E-Value=0) 30 0.55 SB_53183| Best HMM Match : Ras (HMM E-Value=0) 29 0.73 SB_20827| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.73 SB_38760| Best HMM Match : Ras (HMM E-Value=4.6e-06) 29 0.73 SB_46477| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.96 SB_33999| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.96 SB_52511| Best HMM Match : RVT_1 (HMM E-Value=0.00044) 29 0.96 SB_17523| Best HMM Match : MMR_HSR1 (HMM E-Value=4.2) 29 1.3 SB_7861| Best HMM Match : MMR_HSR1 (HMM E-Value=0.96) 29 1.3 SB_5178| Best HMM Match : Ras (HMM E-Value=9e-10) 29 1.3 SB_49432| Best HMM Match : Ras (HMM E-Value=1.4e-12) 28 1.7 SB_31699| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.7 SB_37124| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.2 SB_52469| Best HMM Match : MSSP (HMM E-Value=0.54) 27 2.9 SB_24106| Best HMM Match : Ras (HMM E-Value=1e-35) 27 2.9 SB_1242| Best HMM Match : DUF590 (HMM E-Value=4.2e-05) 27 2.9 SB_58700| Best HMM Match : Ras (HMM E-Value=2.7e-15) 27 3.9 SB_24838| Best HMM Match : NCD1 (HMM E-Value=2.3e-32) 27 3.9 SB_52755| Best HMM Match : 7tm_1 (HMM E-Value=2.9e-16) 27 3.9 SB_51310| Best HMM Match : NCD1 (HMM E-Value=2.3e-32) 27 3.9 SB_51220| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.9 SB_37123| Best HMM Match : Extensin_2 (HMM E-Value=1.5) 27 3.9 SB_52502| Best HMM Match : GTP_CDC (HMM E-Value=1.9e-06) 27 5.1 SB_8335| Best HMM Match : Dehydrin (HMM E-Value=7.2) 27 5.1 SB_7440| Best HMM Match : fn3 (HMM E-Value=0.35) 27 5.1 SB_50693| Best HMM Match : C2 (HMM E-Value=0) 26 6.8 SB_34085| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 6.8 SB_48437| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 9.0 SB_41076| Best HMM Match : Ras (HMM E-Value=1.90016e-42) 26 9.0 SB_35480| Best HMM Match : RVT_1 (HMM E-Value=0.0085) 26 9.0 SB_32837| Best HMM Match : RVT_1 (HMM E-Value=8.3e-17) 26 9.0 SB_27763| Best HMM Match : VapD_N (HMM E-Value=10) 26 9.0 SB_22289| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 9.0 SB_16788| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 9.0 SB_2102| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 9.0 SB_52616| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 9.0 SB_31930| Best HMM Match : RVT_1 (HMM E-Value=1.3e-33) 26 9.0 SB_26483| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 9.0 SB_20766| Best HMM Match : VapD_N (HMM E-Value=10) 26 9.0 SB_19059| Best HMM Match : Arm (HMM E-Value=0.044) 26 9.0 SB_6444| Best HMM Match : CRAM_rpt (HMM E-Value=3e-11) 26 9.0 SB_6352| Best HMM Match : GTP_CDC (HMM E-Value=1.49939e-42) 26 9.0 >SB_50855| Best HMM Match : Ras (HMM E-Value=0) Length = 733 Score = 87.4 bits (207), Expect = 3e-18 Identities = 43/52 (82%), Positives = 45/52 (86%) Frame = +3 Query: 183 MATNRTGAAQRPNGAPQTKVCQFKLVLLGQSAVGKSSLVLRFVKGQFHESQE 338 MA NR G AQRPNGA K+CQFKLVLLG+SAVGKSSLVLRFVKGQFHE QE Sbjct: 1 MAANR-GGAQRPNGATMGKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQE 51 >SB_27557| Best HMM Match : Ras (HMM E-Value=0) Length = 184 Score = 41.1 bits (92), Expect = 2e-04 Identities = 16/31 (51%), Positives = 25/31 (80%) Frame = +3 Query: 246 QFKLVLLGQSAVGKSSLVLRFVKGQFHESQE 338 QF+++L+G S VGKSSL+ +F +GQF E+ + Sbjct: 13 QFRIILIGDSTVGKSSLLRQFTEGQFFENSD 43 >SB_8853| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 38.3 bits (85), Expect = 0.002 Identities = 15/26 (57%), Positives = 21/26 (80%) Frame = +3 Query: 249 FKLVLLGQSAVGKSSLVLRFVKGQFH 326 FK+VL+G S VGKS+L+ R+ K +FH Sbjct: 19 FKIVLIGDSGVGKSNLLSRYTKNEFH 44 >SB_7589| Best HMM Match : Ras (HMM E-Value=0) Length = 640 Score = 37.5 bits (83), Expect = 0.003 Identities = 15/28 (53%), Positives = 21/28 (75%) Frame = +3 Query: 249 FKLVLLGQSAVGKSSLVLRFVKGQFHES 332 FK+VL G +AVGKSS +LR + +FH + Sbjct: 443 FKIVLAGDAAVGKSSFILRLCRNRFHSA 470 >SB_47462| Best HMM Match : Ras (HMM E-Value=0) Length = 385 Score = 36.7 bits (81), Expect = 0.005 Identities = 15/31 (48%), Positives = 23/31 (74%) Frame = +3 Query: 246 QFKLVLLGQSAVGKSSLVLRFVKGQFHESQE 338 ++K+V+LG VGKS+L ++FV GQF E + Sbjct: 3 EYKVVVLGSGGVGKSALTVQFVTGQFVEKYD 33 >SB_42246| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 310 Score = 36.7 bits (81), Expect = 0.005 Identities = 17/28 (60%), Positives = 23/28 (82%), Gaps = 1/28 (3%) Frame = +3 Query: 249 FKLVLLGQSAVGKSSLVLRFVKGQF-HE 329 + LVLLGQ+ VGKS+L++RF G+F HE Sbjct: 128 YSLVLLGQAGVGKSALLVRFCTGRFIHE 155 >SB_1071| Best HMM Match : Ras (HMM E-Value=0) Length = 228 Score = 36.7 bits (81), Expect = 0.005 Identities = 15/31 (48%), Positives = 23/31 (74%) Frame = +3 Query: 246 QFKLVLLGQSAVGKSSLVLRFVKGQFHESQE 338 ++K+V+LG VGKS+L ++FV GQF E + Sbjct: 3 EYKVVVLGSGGVGKSALTVQFVTGQFVEKYD 33 >SB_52002| Best HMM Match : Ras (HMM E-Value=2.3e-19) Length = 351 Score = 35.9 bits (79), Expect = 0.008 Identities = 15/27 (55%), Positives = 20/27 (74%) Frame = +3 Query: 249 FKLVLLGQSAVGKSSLVLRFVKGQFHE 329 F++V+LG VGK+SLV RF+ G F E Sbjct: 108 FRVVVLGSGGVGKTSLVKRFISGTFSE 134 >SB_4971| Best HMM Match : Ras (HMM E-Value=0) Length = 209 Score = 35.5 bits (78), Expect = 0.011 Identities = 16/25 (64%), Positives = 19/25 (76%) Frame = +3 Query: 249 FKLVLLGQSAVGKSSLVLRFVKGQF 323 FKL+L+G S VGKSSL+LRF F Sbjct: 9 FKLLLIGDSGVGKSSLLLRFADDTF 33 >SB_29253| Best HMM Match : Ras (HMM E-Value=2.8e-05) Length = 68 Score = 35.1 bits (77), Expect = 0.015 Identities = 14/26 (53%), Positives = 21/26 (80%) Frame = +3 Query: 249 FKLVLLGQSAVGKSSLVLRFVKGQFH 326 FK+VL+G S VGKS+L+ RF + +F+ Sbjct: 12 FKVVLIGDSGVGKSNLLSRFTRNEFN 37 >SB_13045| Best HMM Match : Ras (HMM E-Value=0) Length = 629 Score = 35.1 bits (77), Expect = 0.015 Identities = 14/25 (56%), Positives = 20/25 (80%) Frame = +3 Query: 249 FKLVLLGQSAVGKSSLVLRFVKGQF 323 +K+VL+G S VGKSSL+ RF + +F Sbjct: 13 YKIVLIGDSGVGKSSLLSRFTRNEF 37 >SB_45967| Best HMM Match : Ras (HMM E-Value=2.1e-07) Length = 92 Score = 34.3 bits (75), Expect = 0.026 Identities = 14/29 (48%), Positives = 23/29 (79%) Frame = +3 Query: 252 KLVLLGQSAVGKSSLVLRFVKGQFHESQE 338 K+ ++G +VGKSSL ++FV+GQF +S + Sbjct: 8 KIAVMGFRSVGKSSLTIQFVEGQFVDSYD 36 >SB_34024| Best HMM Match : VLPT (HMM E-Value=3.7) Length = 368 Score = 33.9 bits (74), Expect = 0.034 Identities = 13/26 (50%), Positives = 22/26 (84%) Frame = +3 Query: 246 QFKLVLLGQSAVGKSSLVLRFVKGQF 323 ++ +V+LG + VGK++LV+RFV G+F Sbjct: 324 KYSMVVLGAAGVGKTALVVRFVTGRF 349 >SB_24842| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 33.5 bits (73), Expect = 0.045 Identities = 14/29 (48%), Positives = 21/29 (72%) Frame = +3 Query: 249 FKLVLLGQSAVGKSSLVLRFVKGQFHESQ 335 FK++L+G + VGK+ LV +F KG F +Q Sbjct: 8 FKIILVGDANVGKTCLVRQFTKGYFPPNQ 36 >SB_12762| Best HMM Match : Ras (HMM E-Value=2.2e-21) Length = 242 Score = 33.5 bits (73), Expect = 0.045 Identities = 14/33 (42%), Positives = 24/33 (72%) Frame = +3 Query: 231 QTKVCQFKLVLLGQSAVGKSSLVLRFVKGQFHE 329 +T + +F +V G S+VGK+SL+LRF+ F++ Sbjct: 23 ETSLRRFTIVFFGASSVGKTSLILRFLGYAFND 55 >SB_17958| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 271 Score = 33.1 bits (72), Expect = 0.059 Identities = 13/25 (52%), Positives = 19/25 (76%) Frame = +3 Query: 249 FKLVLLGQSAVGKSSLVLRFVKGQF 323 FK++++G VGK+SL+ RF KG F Sbjct: 12 FKVLVVGDPGVGKTSLIRRFTKGYF 36 >SB_22342| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 778 Score = 32.3 bits (70), Expect = 0.10 Identities = 14/20 (70%), Positives = 17/20 (85%) Frame = +3 Query: 249 FKLVLLGQSAVGKSSLVLRF 308 FKL+L+G S VGKS L+LRF Sbjct: 9 FKLLLIGDSGVGKSCLLLRF 28 >SB_6223| Best HMM Match : Ras (HMM E-Value=0) Length = 1665 Score = 32.3 bits (70), Expect = 0.10 Identities = 12/26 (46%), Positives = 20/26 (76%) Frame = +3 Query: 246 QFKLVLLGQSAVGKSSLVLRFVKGQF 323 Q+KLV++G VGKS+L ++F++ F Sbjct: 11 QYKLVVVGGGGVGKSALTIQFIQSHF 36 >SB_45519| Best HMM Match : RNB (HMM E-Value=1.6e-35) Length = 2748 Score = 32.3 bits (70), Expect = 0.10 Identities = 12/27 (44%), Positives = 20/27 (74%) Frame = +3 Query: 249 FKLVLLGQSAVGKSSLVLRFVKGQFHE 329 F+L ++G VGKSS+ +R++K +F E Sbjct: 2599 FRLCVVGSGGVGKSSVTIRYLKNEFTE 2625 >SB_32061| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 919 Score = 31.9 bits (69), Expect = 0.14 Identities = 13/24 (54%), Positives = 19/24 (79%) Frame = +3 Query: 252 KLVLLGQSAVGKSSLVLRFVKGQF 323 K++++G+S VGKSSL+LRF F Sbjct: 10 KILIVGESGVGKSSLLLRFTDDTF 33 >SB_24843| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 265 Score = 31.5 bits (68), Expect = 0.18 Identities = 13/30 (43%), Positives = 19/30 (63%) Frame = +3 Query: 249 FKLVLLGQSAVGKSSLVLRFVKGQFHESQE 338 FK++++G S VGK+ L R G+F E E Sbjct: 47 FKIIIIGDSNVGKTCLAYRLCTGKFPERTE 76 >SB_33745| Best HMM Match : Ras (HMM E-Value=2.5e-21) Length = 115 Score = 31.5 bits (68), Expect = 0.18 Identities = 14/35 (40%), Positives = 21/35 (60%) Frame = +3 Query: 219 NGAPQTKVCQFKLVLLGQSAVGKSSLVLRFVKGQF 323 + A Q FKL+++G SAVGK+S + R+ F Sbjct: 12 DAADQNFDYMFKLLIIGNSAVGKTSFLFRYADDSF 46 >SB_31418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 359 Score = 31.5 bits (68), Expect = 0.18 Identities = 20/51 (39%), Positives = 25/51 (49%), Gaps = 1/51 (1%) Frame = -3 Query: 334 WDSWNCPLTN-RSTREDLPTADWPNNTSLNWQTFVCGAPLGLCAAPVLFVA 185 W S+ C L R+ ED P AD S Q+F C P+G C V+ VA Sbjct: 36 WSSFTCVLEEVRNPTED-PVADNQELNSFVPQSFTCADPVGFCWWIVVKVA 85 >SB_59261| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 5445 Score = 30.7 bits (66), Expect = 0.32 Identities = 14/41 (34%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = -2 Query: 251 ELADFCLWSAI-GPLCGSGPVCRHIPPCHCSSVLNFFLGDR 132 E+ DFC +++ GP C +G VC + P + + F G R Sbjct: 4434 EIRDFCALASVNGPACFNGGVCTNTPTSYTCTCARGFHGRR 4474 >SB_58218| Best HMM Match : Ras (HMM E-Value=1.4013e-44) Length = 212 Score = 30.3 bits (65), Expect = 0.42 Identities = 13/25 (52%), Positives = 18/25 (72%) Frame = +3 Query: 249 FKLVLLGQSAVGKSSLVLRFVKGQF 323 FK+VLLG++ VGK+SL R + F Sbjct: 12 FKVVLLGEAGVGKTSLFYRLKENHF 36 >SB_56256| Best HMM Match : Ras (HMM E-Value=8.9e-31) Length = 506 Score = 30.3 bits (65), Expect = 0.42 Identities = 16/42 (38%), Positives = 27/42 (64%) Frame = +3 Query: 213 RPNGAPQTKVCQFKLVLLGQSAVGKSSLVLRFVKGQFHESQE 338 RPNG Q ++ ++L+G S GK++L+ +V+ QF+E E Sbjct: 226 RPNG--QIRI---PVILVGDSECGKTALLNAYVRNQFNEKYE 262 >SB_37884| Best HMM Match : Ubie_methyltran (HMM E-Value=0.00014) Length = 399 Score = 30.3 bits (65), Expect = 0.42 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = -3 Query: 337 SWDSWNCPLTNRSTREDLPTADWPNNTSL 251 S+ S NCP+TN D PT P+ T+L Sbjct: 7 SYFSTNCPVTNCKVNADFPTPPDPSTTTL 35 >SB_45581| Best HMM Match : Ras (HMM E-Value=0.069) Length = 284 Score = 30.3 bits (65), Expect = 0.42 Identities = 13/32 (40%), Positives = 20/32 (62%) Frame = +3 Query: 228 PQTKVCQFKLVLLGQSAVGKSSLVLRFVKGQF 323 P V ++V+LGQ VGKS+L +R + +F Sbjct: 10 PNDNVRSLRVVVLGQDGVGKSALTVRLLTKRF 41 >SB_28695| Best HMM Match : Ras (HMM E-Value=0) Length = 1058 Score = 30.3 bits (65), Expect = 0.42 Identities = 14/28 (50%), Positives = 18/28 (64%) Frame = +3 Query: 249 FKLVLLGQSAVGKSSLVLRFVKGQFHES 332 FK+V +G S VGKSS + RF Q+ S Sbjct: 897 FKVVFIGDSGVGKSSFLHRFCHDQWKPS 924 >SB_36483| Best HMM Match : Ras (HMM E-Value=0) Length = 213 Score = 29.9 bits (64), Expect = 0.55 Identities = 13/26 (50%), Positives = 19/26 (73%) Frame = +3 Query: 249 FKLVLLGQSAVGKSSLVLRFVKGQFH 326 FK+++LG VGKSSL+ RF +F+ Sbjct: 11 FKVLVLGDCNVGKSSLIRRFHDDEFN 36 >SB_3743| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 365 Score = 29.9 bits (64), Expect = 0.55 Identities = 14/29 (48%), Positives = 17/29 (58%) Frame = +3 Query: 252 KLVLLGQSAVGKSSLVLRFVKGQFHESQE 338 K+V LG VGKSSL RF+ F E + Sbjct: 165 KIVFLGDQGVGKSSLAGRFIYDIFEEKYQ 193 >SB_39378| Best HMM Match : VWA (HMM E-Value=0) Length = 2865 Score = 29.9 bits (64), Expect = 0.55 Identities = 14/41 (34%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = -2 Query: 251 ELADFCLWSAI-GPLCGSGPVCRHIPPCHCSSVLNFFLGDR 132 E+ DFC +++ GP C +G VC + P + + F G R Sbjct: 2650 EIRDFCALASVNGPACFNGGVCTNTPTSYTCTCARGFHGLR 2690 >SB_53183| Best HMM Match : Ras (HMM E-Value=0) Length = 834 Score = 29.5 bits (63), Expect = 0.73 Identities = 12/26 (46%), Positives = 18/26 (69%) Frame = +3 Query: 249 FKLVLLGQSAVGKSSLVLRFVKGQFH 326 FKL+L+G S VGK+ ++ RF F+ Sbjct: 10 FKLLLIGDSGVGKTCILFRFSDDAFN 35 >SB_20827| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 419 Score = 29.5 bits (63), Expect = 0.73 Identities = 13/21 (61%), Positives = 16/21 (76%), Gaps = 1/21 (4%) Frame = +2 Query: 242 LPVQAGV-VGPVCGRQVLPGA 301 +P+ AG VGP GR+VLPGA Sbjct: 87 MPIPAGTWVGPYAGRRVLPGA 107 >SB_38760| Best HMM Match : Ras (HMM E-Value=4.6e-06) Length = 965 Score = 29.5 bits (63), Expect = 0.73 Identities = 11/24 (45%), Positives = 19/24 (79%) Frame = +3 Query: 252 KLVLLGQSAVGKSSLVLRFVKGQF 323 K+V++G+ VGKS+L +RF+ +F Sbjct: 863 KVVIIGEDGVGKSALTVRFLTKRF 886 >SB_46477| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 6116 Score = 29.1 bits (62), Expect = 0.96 Identities = 13/26 (50%), Positives = 18/26 (69%) Frame = +3 Query: 252 KLVLLGQSAVGKSSLVLRFVKGQFHE 329 KLV++G A GK+ L++ F K QF E Sbjct: 5931 KLVIVGDGACGKTCLLIVFSKDQFPE 5956 >SB_33999| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 29.1 bits (62), Expect = 0.96 Identities = 11/23 (47%), Positives = 18/23 (78%) Frame = +3 Query: 249 FKLVLLGQSAVGKSSLVLRFVKG 317 FK++++G + VGK+S V R+V G Sbjct: 23 FKVLIVGDATVGKTSFVQRYVHG 45 >SB_52511| Best HMM Match : RVT_1 (HMM E-Value=0.00044) Length = 513 Score = 29.1 bits (62), Expect = 0.96 Identities = 12/36 (33%), Positives = 17/36 (47%) Frame = -3 Query: 265 NNTSLNWQTFVCGAPLGLCAAPVLFVAISLPVTVAP 158 N TS +W + G P G P LF+ T++P Sbjct: 337 NGTSSDWSPVISGVPQGTMLGPTLFLLFMTCRTLSP 372 >SB_17523| Best HMM Match : MMR_HSR1 (HMM E-Value=4.2) Length = 87 Score = 28.7 bits (61), Expect = 1.3 Identities = 15/36 (41%), Positives = 21/36 (58%) Frame = +3 Query: 219 NGAPQTKVCQFKLVLLGQSAVGKSSLVLRFVKGQFH 326 + A TKV +K+V G VGK+SL LR +F+ Sbjct: 18 SSANHTKVPLYKVVFAGFRGVGKTSLFLRIRDEKFY 53 >SB_7861| Best HMM Match : MMR_HSR1 (HMM E-Value=0.96) Length = 244 Score = 28.7 bits (61), Expect = 1.3 Identities = 17/42 (40%), Positives = 22/42 (52%) Frame = +3 Query: 198 TGAAQRPNGAPQTKVCQFKLVLLGQSAVGKSSLVLRFVKGQF 323 T Q +G P FK+ +LG SAVGK+SL+ K F Sbjct: 174 TSNIQMGSGLPPV---DFKMAILGGSAVGKTSLMRALFKKPF 212 >SB_5178| Best HMM Match : Ras (HMM E-Value=9e-10) Length = 166 Score = 28.7 bits (61), Expect = 1.3 Identities = 12/29 (41%), Positives = 19/29 (65%) Frame = +3 Query: 252 KLVLLGQSAVGKSSLVLRFVKGQFHESQE 338 ++ + G + VGK+S+V RF G+F E E Sbjct: 10 EIAVFGGAGVGKTSIVKRFYCGKFSEEYE 38 >SB_49432| Best HMM Match : Ras (HMM E-Value=1.4e-12) Length = 460 Score = 28.3 bits (60), Expect = 1.7 Identities = 11/24 (45%), Positives = 19/24 (79%) Frame = +3 Query: 252 KLVLLGQSAVGKSSLVLRFVKGQF 323 ++V+LG+ VGKS+L +RF+ +F Sbjct: 18 RVVVLGKDGVGKSALTVRFLTRRF 41 >SB_31699| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 6119 Score = 28.3 bits (60), Expect = 1.7 Identities = 13/46 (28%), Positives = 26/46 (56%) Frame = +3 Query: 78 LFKCVINDNFGVTATS*RSVAQEKVQNGATVTGRDMATNRTGAAQR 215 +FKCV+ ++FG+ + S + E+ + + + D AT+R +R Sbjct: 4953 IFKCVLLNDFGIASCS-AEILVEEDEESYSESSADEATDRNARIER 4997 >SB_37124| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 60 Score = 27.9 bits (59), Expect = 2.2 Identities = 12/27 (44%), Positives = 21/27 (77%) Frame = +3 Query: 252 KLVLLGQSAVGKSSLVLRFVKGQFHES 332 K+VLLG+ GK+SLV R++ +F+++ Sbjct: 29 KVVLLGKEYSGKTSLVERYLHHRFNDN 55 >SB_52469| Best HMM Match : MSSP (HMM E-Value=0.54) Length = 341 Score = 27.5 bits (58), Expect = 2.9 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = -2 Query: 236 CLWSAIGPLCGSGPVCRHI 180 C ++GPL GPVC+H+ Sbjct: 11 CKHVSMGPLTTGGPVCKHV 29 Score = 27.5 bits (58), Expect = 2.9 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = -2 Query: 236 CLWSAIGPLCGSGPVCRHI 180 C +GPL GPVC+HI Sbjct: 289 CKHVGMGPLTTGGPVCKHI 307 Score = 27.5 bits (58), Expect = 2.9 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = -2 Query: 236 CLWSAIGPLCGSGPVCRHI 180 C +GPL GPVC+HI Sbjct: 304 CKHIGMGPLTTGGPVCKHI 322 Score = 27.1 bits (57), Expect = 3.9 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -2 Query: 236 CLWSAIGPLCGSGPVCRHI 180 C +GPL GPVC+H+ Sbjct: 26 CKHVGMGPLTTGGPVCKHV 44 Score = 27.1 bits (57), Expect = 3.9 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -2 Query: 236 CLWSAIGPLCGSGPVCRHI 180 C +GPL GPVC+H+ Sbjct: 71 CKHVGMGPLTTGGPVCKHV 89 Score = 27.1 bits (57), Expect = 3.9 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -2 Query: 236 CLWSAIGPLCGSGPVCRHI 180 C +GPL GPVC+H+ Sbjct: 150 CKHVGMGPLTTGGPVCKHV 168 Score = 27.1 bits (57), Expect = 3.9 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -2 Query: 236 CLWSAIGPLCGSGPVCRHI 180 C +GPL GPVC+H+ Sbjct: 214 CKHVGMGPLTTGGPVCKHV 232 Score = 27.1 bits (57), Expect = 3.9 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -2 Query: 236 CLWSAIGPLCGSGPVCRHI 180 C +GPL GPVC+H+ Sbjct: 259 CKHVGMGPLTTGGPVCKHV 277 >SB_24106| Best HMM Match : Ras (HMM E-Value=1e-35) Length = 263 Score = 27.5 bits (58), Expect = 2.9 Identities = 10/25 (40%), Positives = 19/25 (76%) Frame = +3 Query: 249 FKLVLLGQSAVGKSSLVLRFVKGQF 323 +++ LLG VGK++L++RF+ +F Sbjct: 6 YRIALLGDEGVGKTALLVRFLCHRF 30 >SB_1242| Best HMM Match : DUF590 (HMM E-Value=4.2e-05) Length = 195 Score = 27.5 bits (58), Expect = 2.9 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = -3 Query: 337 SWDSWNCPLTNRSTRE 290 +WD WNC T R T E Sbjct: 119 AWDDWNCKTTARRTTE 134 >SB_58700| Best HMM Match : Ras (HMM E-Value=2.7e-15) Length = 857 Score = 27.1 bits (57), Expect = 3.9 Identities = 10/21 (47%), Positives = 17/21 (80%) Frame = +3 Query: 249 FKLVLLGQSAVGKSSLVLRFV 311 FK++++G VGK+SL+ R+V Sbjct: 672 FKVLVIGDLGVGKTSLIKRYV 692 >SB_24838| Best HMM Match : NCD1 (HMM E-Value=2.3e-32) Length = 539 Score = 27.1 bits (57), Expect = 3.9 Identities = 14/43 (32%), Positives = 25/43 (58%) Frame = +2 Query: 137 RPRKSSERSYSDREGYGDKQDRSRTEAQWRSTDKSLPVQAGVV 265 + ++ SER YS++EG D Q+ +++ S D S V G++ Sbjct: 371 KKQRRSERYYSNKEGKDDPQEMD--DSRHESQDSSDGVMEGMI 411 >SB_52755| Best HMM Match : 7tm_1 (HMM E-Value=2.9e-16) Length = 366 Score = 27.1 bits (57), Expect = 3.9 Identities = 21/61 (34%), Positives = 30/61 (49%), Gaps = 1/61 (1%) Frame = +3 Query: 144 EKVQNGATVTGRDMATNRTGAAQRPNGAPQTKVCQFKLVLLGQSAVGKSSLVLRFV-KGQ 320 E +Q + + NRTG+ P+ + F LVLLG S V +SLV+ V K + Sbjct: 5 EDLQRFSNASSLSKNGNRTGSFSPPSEETLLTIFIF-LVLLGLSIVAMNSLVIVLVHKNR 63 Query: 321 F 323 F Sbjct: 64 F 64 >SB_51310| Best HMM Match : NCD1 (HMM E-Value=2.3e-32) Length = 423 Score = 27.1 bits (57), Expect = 3.9 Identities = 14/43 (32%), Positives = 25/43 (58%) Frame = +2 Query: 137 RPRKSSERSYSDREGYGDKQDRSRTEAQWRSTDKSLPVQAGVV 265 + ++ SER YS++EG D Q+ +++ S D S V G++ Sbjct: 371 KKQRRSERYYSNKEGKDDPQEMD--DSRHESQDSSDGVMEGMI 411 >SB_51220| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1601 Score = 27.1 bits (57), Expect = 3.9 Identities = 22/67 (32%), Positives = 32/67 (47%), Gaps = 6/67 (8%) Frame = -2 Query: 338 LLGLVELSLDESEHQGGLAYRRLAQQHQLELADFCLWSAIG------PLCGSGPVCRHIP 177 +L L SL + H G+A ++AQ ++LAD L G P C +G V R P Sbjct: 1327 VLVLSNYSLGNAAHCKGIAVSQVAQLTLMDLADVMLREVHGCPPPTPPPCRTGTV-RLSP 1385 Query: 176 PCHCSSV 156 +C+ V Sbjct: 1386 STNCTDV 1392 >SB_37123| Best HMM Match : Extensin_2 (HMM E-Value=1.5) Length = 318 Score = 27.1 bits (57), Expect = 3.9 Identities = 13/35 (37%), Positives = 18/35 (51%), Gaps = 1/35 (2%) Frame = -3 Query: 337 SWDSWNCPLTNRSTREDLP-TADWPNNTSLNWQTF 236 +WD+ +CPLT P T W N +S QT+ Sbjct: 205 TWDNLSCPLTQTWDNSSSPLTQTWDNPSSPLTQTW 239 >SB_52502| Best HMM Match : GTP_CDC (HMM E-Value=1.9e-06) Length = 101 Score = 26.6 bits (56), Expect = 5.1 Identities = 14/39 (35%), Positives = 23/39 (58%), Gaps = 3/39 (7%) Frame = +3 Query: 192 NRTGAAQRPNGAPQTKV---CQFKLVLLGQSAVGKSSLV 299 N G A PN + V +F L+++G+S +GKS+L+ Sbjct: 3 NYVGFANLPNQVHRKSVKKGFEFTLMVVGESGLGKSTLI 41 >SB_8335| Best HMM Match : Dehydrin (HMM E-Value=7.2) Length = 531 Score = 26.6 bits (56), Expect = 5.1 Identities = 10/33 (30%), Positives = 16/33 (48%) Frame = +2 Query: 140 PRKSSERSYSDREGYGDKQDRSRTEAQWRSTDK 238 PR+ R Y +R G G + + R + W D+ Sbjct: 170 PREERPRGYRERVGAGSPEAQRRRDPDWPREDR 202 >SB_7440| Best HMM Match : fn3 (HMM E-Value=0.35) Length = 602 Score = 26.6 bits (56), Expect = 5.1 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = -3 Query: 265 NNTSLNWQTFVCGAPLGLCAAPVLF 191 N NW T G P G +PVLF Sbjct: 531 NGAKSNWLTVKSGVPQGTVLSPVLF 555 >SB_50693| Best HMM Match : C2 (HMM E-Value=0) Length = 1049 Score = 26.2 bits (55), Expect = 6.8 Identities = 14/40 (35%), Positives = 20/40 (50%) Frame = +2 Query: 140 PRKSSERSYSDREGYGDKQDRSRTEAQWRSTDKSLPVQAG 259 PRK+S RS DR+ Y D + ++ T K+ V G Sbjct: 905 PRKNSGRSLPDRDDYWLADDEGQGDSPVSKTPKTTLVANG 944 >SB_34085| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 296 Score = 26.2 bits (55), Expect = 6.8 Identities = 20/61 (32%), Positives = 30/61 (49%) Frame = -3 Query: 265 NNTSLNWQTFVCGAPLGLCAAPVLFVAISLPVTVAPF*TFSWATDLHEVAVTPKLSLITH 86 N T + W T G G C F ++L V+P + T ++ + TP++SLITH Sbjct: 12 NTTFVVWNT--TGKDFGQC-----FENLAL---VSPLNSLLLCTSIYFIIRTPRVSLITH 61 Query: 85 L 83 L Sbjct: 62 L 62 >SB_48437| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4247 Score = 25.8 bits (54), Expect = 9.0 Identities = 14/41 (34%), Positives = 21/41 (51%), Gaps = 7/41 (17%) Frame = +2 Query: 170 DREGYGDKQDRSRTEAQW------RSTDK-SLPVQAGVVGP 271 D +G G+K+D + E QW +STD+ P+ G P Sbjct: 2666 DSQGKGEKEDANDVEVQWNDGSGQKSTDRQEKPIAGGKTKP 2706 >SB_41076| Best HMM Match : Ras (HMM E-Value=1.90016e-42) Length = 704 Score = 25.8 bits (54), Expect = 9.0 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = +3 Query: 246 QFKLVLLGQSAVGKSSLVLRFVKGQF 323 +FK +++G S VGKS LV + F Sbjct: 350 EFKTLIIGNSGVGKSCLVNKLKNPHF 375 >SB_35480| Best HMM Match : RVT_1 (HMM E-Value=0.0085) Length = 243 Score = 25.8 bits (54), Expect = 9.0 Identities = 9/26 (34%), Positives = 13/26 (50%) Frame = -3 Query: 265 NNTSLNWQTFVCGAPLGLCAAPVLFV 188 N +W T + G P G P+LF+ Sbjct: 80 NGACSSWSTVLSGVPQGTVLGPILFL 105 >SB_32837| Best HMM Match : RVT_1 (HMM E-Value=8.3e-17) Length = 327 Score = 25.8 bits (54), Expect = 9.0 Identities = 9/26 (34%), Positives = 13/26 (50%) Frame = -3 Query: 265 NNTSLNWQTFVCGAPLGLCAAPVLFV 188 N +W T + G P G P+LF+ Sbjct: 103 NGACSSWSTVLSGVPQGTVLGPILFL 128 >SB_27763| Best HMM Match : VapD_N (HMM E-Value=10) Length = 243 Score = 25.8 bits (54), Expect = 9.0 Identities = 9/26 (34%), Positives = 13/26 (50%) Frame = -3 Query: 265 NNTSLNWQTFVCGAPLGLCAAPVLFV 188 N +W T + G P G P+LF+ Sbjct: 19 NGACSSWSTVLSGVPQGTVLGPILFL 44 >SB_22289| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1102 Score = 25.8 bits (54), Expect = 9.0 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -3 Query: 262 NTSLNWQTFVCGAPLGL 212 N SLN T+ CG PLG+ Sbjct: 824 NDSLNLLTYSCGQPLGM 840 >SB_16788| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1468 Score = 25.8 bits (54), Expect = 9.0 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = -3 Query: 337 SWDSWNCPLTNRST 296 +WD WNC T R T Sbjct: 623 AWDDWNCKTTARRT 636 Score = 25.8 bits (54), Expect = 9.0 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = -3 Query: 337 SWDSWNCPLTNRST 296 +WD WNC T R T Sbjct: 988 AWDDWNCKTTARRT 1001 >SB_2102| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2396 Score = 25.8 bits (54), Expect = 9.0 Identities = 9/26 (34%), Positives = 13/26 (50%) Frame = -3 Query: 265 NNTSLNWQTFVCGAPLGLCAAPVLFV 188 N +W T + G P G P+LF+ Sbjct: 1944 NGACSSWSTVLSGVPQGTVLGPILFL 1969 >SB_52616| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1855 Score = 25.8 bits (54), Expect = 9.0 Identities = 9/26 (34%), Positives = 13/26 (50%) Frame = -3 Query: 265 NNTSLNWQTFVCGAPLGLCAAPVLFV 188 N +W T + G P G P+LF+ Sbjct: 1674 NGACSSWSTVLSGVPQGTVLGPILFL 1699 >SB_31930| Best HMM Match : RVT_1 (HMM E-Value=1.3e-33) Length = 405 Score = 25.8 bits (54), Expect = 9.0 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = -3 Query: 265 NNTSLNWQTFVCGAPLGLCAAPVLFVAISLPV 170 N SL+ Q +CG PLG P+L+ + P+ Sbjct: 270 NGFSLS-QKMLCGVPLGSVLGPMLYSLYTAPL 300 >SB_26483| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1702 Score = 25.8 bits (54), Expect = 9.0 Identities = 9/26 (34%), Positives = 13/26 (50%) Frame = -3 Query: 265 NNTSLNWQTFVCGAPLGLCAAPVLFV 188 N +W T + G P G P+LF+ Sbjct: 512 NGACSSWSTVLSGVPQGTVLGPILFL 537 >SB_20766| Best HMM Match : VapD_N (HMM E-Value=10) Length = 182 Score = 25.8 bits (54), Expect = 9.0 Identities = 9/26 (34%), Positives = 13/26 (50%) Frame = -3 Query: 265 NNTSLNWQTFVCGAPLGLCAAPVLFV 188 N +W T + G P G P+LF+ Sbjct: 28 NGACSSWSTVLSGVPQGTVLGPILFL 53 >SB_19059| Best HMM Match : Arm (HMM E-Value=0.044) Length = 603 Score = 25.8 bits (54), Expect = 9.0 Identities = 13/37 (35%), Positives = 18/37 (48%) Frame = +2 Query: 140 PRKSSERSYSDREGYGDKQDRSRTEAQWRSTDKSLPV 250 PR S + DR G GDK+ R + +ST L + Sbjct: 152 PRSESSKKTMDRNGSGDKRKRRQHLDGDKSTKDELAI 188 >SB_6444| Best HMM Match : CRAM_rpt (HMM E-Value=3e-11) Length = 2297 Score = 25.8 bits (54), Expect = 9.0 Identities = 14/35 (40%), Positives = 20/35 (57%) Frame = +3 Query: 114 TATS*RSVAQEKVQNGATVTGRDMATNRTGAAQRP 218 TA + +SV + K ++ VTG +M R GA RP Sbjct: 1743 TAKANKSVDEPKRRSYEPVTGVEMRQKRPGAEARP 1777 >SB_6352| Best HMM Match : GTP_CDC (HMM E-Value=1.49939e-42) Length = 275 Score = 25.8 bits (54), Expect = 9.0 Identities = 10/25 (40%), Positives = 18/25 (72%) Frame = +3 Query: 246 QFKLVLLGQSAVGKSSLVLRFVKGQ 320 +F L+++G S +GKS++V KG+ Sbjct: 114 EFNLMVVGASGLGKSTMVNTLFKGK 138 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,862,677 Number of Sequences: 59808 Number of extensions: 217899 Number of successful extensions: 767 Number of sequences better than 10.0: 73 Number of HSP's better than 10.0 without gapping: 709 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 767 length of database: 16,821,457 effective HSP length: 73 effective length of database: 12,455,473 effective search space used: 485763447 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -