BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0619 (339 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EF127647-1|ABL74413.1| 213|Anopheles gambiae Rab5 protein. 88 7e-20 DQ974169-1|ABJ52809.1| 508|Anopheles gambiae serpin 11 protein. 27 0.26 AF492464-1|AAM11657.1| 803|Anopheles gambiae beta nu integrin s... 25 0.59 DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methopren... 25 0.78 AM085517-1|CAJ30215.1| 339|Anopheles gambiae putative angiotens... 25 1.0 AJ535205-1|CAD59405.1| 1201|Anopheles gambiae SMC3 protein protein. 24 1.4 AJ441131-3|CAD29632.1| 568|Anopheles gambiae putative apyrase/n... 24 1.4 AJ439398-2|CAD28125.1| 568|Anopheles gambiae putative 5' nucleo... 24 1.4 AY146760-1|AAO12075.1| 313|Anopheles gambiae odorant-binding pr... 23 2.4 AJ438610-6|CAD27478.1| 226|Anopheles gambiae hypothetical prote... 23 2.4 AF393487-1|AAL60412.1| 304|Anopheles gambiae odorant binding pr... 23 2.4 AB090823-2|BAC57922.1| 1154|Anopheles gambiae reverse transcript... 23 3.1 DQ182015-1|ABA56307.1| 353|Anopheles gambiae G(alpha)q2 protein. 23 4.2 AJ439398-3|CAD28126.1| 566|Anopheles gambiae putative 5' nucleo... 23 4.2 U29486-1|AAC46995.1| 695|Anopheles gambiae ATP-binding-cassette... 22 5.5 U29485-1|AAC46994.1| 695|Anopheles gambiae ATP-binding-cassette... 22 5.5 U29484-1|AAC47423.1| 673|Anopheles gambiae ATP-binding-cassette... 22 5.5 DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. 22 5.5 DQ182016-1|ABA56308.1| 353|Anopheles gambiae G(alpha)i protein. 21 9.6 AJ441131-4|CAD29633.1| 566|Anopheles gambiae putative apyrase/n... 21 9.6 AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal... 21 9.6 >EF127647-1|ABL74413.1| 213|Anopheles gambiae Rab5 protein. Length = 213 Score = 88.2 bits (209), Expect = 7e-20 Identities = 41/46 (89%), Positives = 43/46 (93%) Frame = +3 Query: 201 GAAQRPNGAPQTKVCQFKLVLLGQSAVGKSSLVLRFVKGQFHESQE 338 GAAQRPNGA Q K+CQFKLVLLG+SAVGKSSLVLRFVKGQFHE QE Sbjct: 9 GAAQRPNGATQNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQE 54 >DQ974169-1|ABJ52809.1| 508|Anopheles gambiae serpin 11 protein. Length = 508 Score = 26.6 bits (56), Expect = 0.26 Identities = 10/19 (52%), Positives = 15/19 (78%) Frame = -2 Query: 59 NVKLENLEQKSKMTTNKHG 3 NVK+ +++QKS +T N HG Sbjct: 431 NVKVSDVKQKSFLTVNPHG 449 Score = 21.8 bits (44), Expect = 7.3 Identities = 8/16 (50%), Positives = 8/16 (50%) Frame = +1 Query: 34 CSRFSSFTFTINDYIC 81 C RF TFT D C Sbjct: 16 CQRFKGSTFTTKDDYC 31 >AF492464-1|AAM11657.1| 803|Anopheles gambiae beta nu integrin subunit AgBnu protein. Length = 803 Score = 25.4 bits (53), Expect = 0.59 Identities = 10/33 (30%), Positives = 18/33 (54%) Frame = -2 Query: 263 QHQLELADFCLWSAIGPLCGSGPVCRHIPPCHC 165 Q++ EL + C+ ++G +GP+C C C Sbjct: 511 QNRRELFEQCVAPSVGDELRTGPICSDRGECIC 543 >DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methoprene-tolerant protein protein. Length = 1115 Score = 25.0 bits (52), Expect = 0.78 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = -2 Query: 203 SGPVCRHIPPCHCSSVLNFFLGDRSSRSRRD 111 + P C +PP H ++ NF R +R+R + Sbjct: 201 ASPRCYPMPPEHMYNMFNFNRNGREARNRAE 231 >AM085517-1|CAJ30215.1| 339|Anopheles gambiae putative angiotensin converting enzymeprecursor protein. Length = 339 Score = 24.6 bits (51), Expect = 1.0 Identities = 15/51 (29%), Positives = 24/51 (47%), Gaps = 2/51 (3%) Frame = +2 Query: 137 RPRKSSERSYSDREGYGDKQ--DRSRTEAQWRSTDKSLPVQAGVVGPVCGR 283 R R+ S SY+DR YG + DR++ ++ P + V P+ R Sbjct: 111 RDRQDSPYSYNDRNRYGGDRGYDRNQNRERYPGDRSPNPYVSDVDNPLLYR 161 >AJ535205-1|CAD59405.1| 1201|Anopheles gambiae SMC3 protein protein. Length = 1201 Score = 24.2 bits (50), Expect = 1.4 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = -2 Query: 281 YRRLAQQHQLELADF 237 Y +L Q+H+ ELADF Sbjct: 686 YSQLIQEHEKELADF 700 >AJ441131-3|CAD29632.1| 568|Anopheles gambiae putative apyrase/nucleotidase protein. Length = 568 Score = 24.2 bits (50), Expect = 1.4 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = +2 Query: 107 RCHGDFVKICRPRKSSERSYSDR 175 RC G + ++ KS +R Y+DR Sbjct: 77 RCIGGYARVVSRVKSLQREYADR 99 >AJ439398-2|CAD28125.1| 568|Anopheles gambiae putative 5' nucleotidase protein. Length = 568 Score = 24.2 bits (50), Expect = 1.4 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = +2 Query: 107 RCHGDFVKICRPRKSSERSYSDR 175 RC G + ++ KS +R Y+DR Sbjct: 77 RCIGGYARVVSRVKSLQREYADR 99 >AY146760-1|AAO12075.1| 313|Anopheles gambiae odorant-binding protein AgamOBP31 protein. Length = 313 Score = 23.4 bits (48), Expect = 2.4 Identities = 9/27 (33%), Positives = 15/27 (55%) Frame = -3 Query: 310 TNRSTREDLPTADWPNNTSLNWQTFVC 230 T+ ++ TA+ PNN ++TF C Sbjct: 107 TSECLERNVHTAELPNNCCQAYETFQC 133 >AJ438610-6|CAD27478.1| 226|Anopheles gambiae hypothetical protein protein. Length = 226 Score = 23.4 bits (48), Expect = 2.4 Identities = 12/43 (27%), Positives = 26/43 (60%) Frame = -2 Query: 185 HIPPCHCSSVLNFFLGDRSSRSRRDTEIIINYTLKQI*SLIVN 57 ++PP +C S+ FLG S+ + +E++ + K++ L++N Sbjct: 43 YVPPLYCDSLSQSFLG--STINGNSSELLKRWRGKRV--LVLN 81 >AF393487-1|AAL60412.1| 304|Anopheles gambiae odorant binding protein 1 protein. Length = 304 Score = 23.4 bits (48), Expect = 2.4 Identities = 9/27 (33%), Positives = 15/27 (55%) Frame = -3 Query: 310 TNRSTREDLPTADWPNNTSLNWQTFVC 230 T+ ++ TA+ PNN ++TF C Sbjct: 107 TSECLERNVHTAELPNNCCQAYETFQC 133 >AB090823-2|BAC57922.1| 1154|Anopheles gambiae reverse transcriptase protein. Length = 1154 Score = 23.0 bits (47), Expect = 3.1 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = +1 Query: 7 CLFVVILDFCSRFSS 51 CL VV LD C+ F++ Sbjct: 577 CLMVVALDICNAFNT 591 >DQ182015-1|ABA56307.1| 353|Anopheles gambiae G(alpha)q2 protein. Length = 353 Score = 22.6 bits (46), Expect = 4.2 Identities = 10/33 (30%), Positives = 19/33 (57%), Gaps = 2/33 (6%) Frame = +3 Query: 246 QFKLVLLGQSAVGKSSLV--LRFVKGQFHESQE 338 + KL+LLG GKS+ + +R + G + ++ Sbjct: 33 ELKLLLLGTGESGKSTFIKQMRIIHGSGYSDED 65 >AJ439398-3|CAD28126.1| 566|Anopheles gambiae putative 5' nucleotidase protein. Length = 566 Score = 22.6 bits (46), Expect = 4.2 Identities = 8/23 (34%), Positives = 14/23 (60%) Frame = +2 Query: 107 RCHGDFVKICRPRKSSERSYSDR 175 RC G + ++ KS ++ Y+DR Sbjct: 79 RCIGGYARVVSRVKSLQQEYADR 101 >U29486-1|AAC46995.1| 695|Anopheles gambiae ATP-binding-cassette protein protein. Length = 695 Score = 22.2 bits (45), Expect = 5.5 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +2 Query: 2 FHVCSWSFWISVLDFPVL 55 F+ W W+SVL P+L Sbjct: 422 FYCILWRSWLSVLKDPML 439 >U29485-1|AAC46994.1| 695|Anopheles gambiae ATP-binding-cassette protein protein. Length = 695 Score = 22.2 bits (45), Expect = 5.5 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +2 Query: 2 FHVCSWSFWISVLDFPVL 55 F+ W W+SVL P+L Sbjct: 422 FYCILWRSWLSVLKDPML 439 >U29484-1|AAC47423.1| 673|Anopheles gambiae ATP-binding-cassette protein protein. Length = 673 Score = 22.2 bits (45), Expect = 5.5 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +2 Query: 2 FHVCSWSFWISVLDFPVL 55 F+ W W+SVL P+L Sbjct: 400 FYCILWRSWLSVLKDPML 417 >DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. Length = 889 Score = 22.2 bits (45), Expect = 5.5 Identities = 11/33 (33%), Positives = 17/33 (51%) Frame = +2 Query: 119 DFVKICRPRKSSERSYSDREGYGDKQDRSRTEA 217 DF+K P+ SE++ R D+Q + T A Sbjct: 650 DFLKAALPKGESEKADEKRAEQKDEQRATDTTA 682 >DQ182016-1|ABA56308.1| 353|Anopheles gambiae G(alpha)i protein. Length = 353 Score = 21.4 bits (43), Expect = 9.6 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = +3 Query: 246 QFKLVLLGQSAVGKSSLV 299 + KL+LLG GKS++V Sbjct: 32 EVKLLLLGAGESGKSTIV 49 >AJ441131-4|CAD29633.1| 566|Anopheles gambiae putative apyrase/nucleotidase protein. Length = 566 Score = 21.4 bits (43), Expect = 9.6 Identities = 8/23 (34%), Positives = 14/23 (60%) Frame = +2 Query: 107 RCHGDFVKICRPRKSSERSYSDR 175 RC G + ++ KS ++ Y+DR Sbjct: 79 RCIGGYGRVVSRVKSLQQEYADR 101 >AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal growth factor receptorprotein. Length = 1433 Score = 21.4 bits (43), Expect = 9.6 Identities = 7/14 (50%), Positives = 9/14 (64%) Frame = +2 Query: 236 KSLPVQAGVVGPVC 277 K P +AG +GP C Sbjct: 735 KRFPQEAGKIGPYC 748 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 364,132 Number of Sequences: 2352 Number of extensions: 7198 Number of successful extensions: 33 Number of sequences better than 10.0: 21 Number of HSP's better than 10.0 without gapping: 32 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 33 length of database: 563,979 effective HSP length: 56 effective length of database: 432,267 effective search space used: 24206952 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -