BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0619 (339 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY081181-1|AAN85553.1| 219|Drosophila melanogaster Rab5 protein. 87 7e-18 AY081180-1|AAN85552.1| 219|Drosophila melanogaster Rab5 protein. 87 7e-18 AY060343-1|AAL25382.1| 219|Drosophila melanogaster GH24702p pro... 87 7e-18 AE014134-396|AAN10426.1| 219|Drosophila melanogaster CG3664-PF,... 87 7e-18 AE014134-395|AAN10425.1| 219|Drosophila melanogaster CG3664-PE,... 87 7e-18 AE014134-394|AAN10424.1| 219|Drosophila melanogaster CG3664-PD,... 87 7e-18 AE014134-393|AAN10423.1| 219|Drosophila melanogaster CG3664-PC,... 87 7e-18 AE014134-392|AAN10422.1| 219|Drosophila melanogaster CG3664-PB,... 87 7e-18 AE014134-391|AAF51265.1| 219|Drosophila melanogaster CG3664-PA,... 87 7e-18 AB035671-1|BAA88244.1| 219|Drosophila melanogaster Rab5 protein... 87 7e-18 AB035353-1|BAA87879.1| 219|Drosophila melanogaster Drab5 protein. 87 7e-18 BT024201-1|ABC86263.1| 283|Drosophila melanogaster RE46661p pro... 40 6e-04 AE014297-1044|AAF54453.1| 233|Drosophila melanogaster CG8500-PA... 40 6e-04 AE014296-1180|AAF50620.1| 434|Drosophila melanogaster CG8641-PA... 37 0.006 D84317-1|BAA21710.1| 197|Drosophila melanogaster rab-related pr... 36 0.010 AY075329-1|AAL68196.1| 197|Drosophila melanogaster GH11193p pro... 36 0.010 AY071340-1|AAL48962.1| 218|Drosophila melanogaster RE37651p pro... 36 0.010 AE014298-1056|AAF46271.1| 218|Drosophila melanogaster CG12156-P... 36 0.010 AE014298-769|AAF46057.1| 197|Drosophila melanogaster CG3129-PA ... 36 0.010 AY119634-1|AAM50288.1| 222|Drosophila melanogaster RE42508p pro... 36 0.013 AE014298-3235|EAA46055.2| 273|Drosophila melanogaster CG17515-P... 36 0.013 D84315-1|BAA21708.1| 214|Drosophila melanogaster rab11 protein. 35 0.023 D84312-1|BAA21705.1| 205|Drosophila melanogaster rab1 protein. 35 0.023 BT012453-1|AAS93724.1| 182|Drosophila melanogaster RE63021p pro... 35 0.023 BT001785-1|AAN71540.1| 214|Drosophila melanogaster RH21315p pro... 35 0.023 AY121695-1|AAM52022.1| 101|Drosophila melanogaster RE66843p pro... 35 0.023 AY113404-1|AAM29409.1| 214|Drosophila melanogaster RE11886p pro... 35 0.023 AY070528-1|AAL47999.1| 214|Drosophila melanogaster GM06568p pro... 35 0.023 AF111427-1|AAC98693.1| 182|Drosophila melanogaster Ras-related ... 35 0.023 AE014297-2966|AAN13857.1| 146|Drosophila melanogaster CG3320-PB... 35 0.023 AE014297-2965|AAF55873.1| 205|Drosophila melanogaster CG3320-PA... 35 0.023 AE014297-2931|AAN13849.1| 214|Drosophila melanogaster CG5771-PB... 35 0.023 AE014297-2930|AAF55850.1| 214|Drosophila melanogaster CG5771-PA... 35 0.023 AE013599-3800|ABC66043.1| 61|Drosophila melanogaster CG3204-PB... 35 0.023 AE013599-3799|AAF47155.1| 182|Drosophila melanogaster CG3204-PA... 35 0.023 AB035354-1|BAA87880.1| 214|Drosophila melanogaster Drab11 protein. 35 0.023 BT010242-1|AAQ23560.1| 498|Drosophila melanogaster RE48016p pro... 35 0.031 AE014298-1475|AAF46610.2| 197|Drosophila melanogaster CG9807-PA... 35 0.031 AE013599-2858|AAF57577.1| 537|Drosophila melanogaster CG9811-PA... 35 0.031 D84314-1|BAA21707.1| 208|Drosophila melanogaster rab6 protein. 34 0.041 AY071139-1|AAL48761.1| 256|Drosophila melanogaster RE17845p pro... 34 0.041 AY060261-1|AAL25300.1| 208|Drosophila melanogaster GH09086p pro... 34 0.041 AE014298-1469|AAN09263.1| 197|Drosophila melanogaster CG32678-P... 34 0.041 AE014134-3093|AAF53798.1| 256|Drosophila melanogaster CG9994-PA... 34 0.041 AE014134-2164|AAF53168.1| 208|Drosophila melanogaster CG6601-PA... 34 0.041 AY071080-1|AAL48702.1| 223|Drosophila melanogaster RE14786p pro... 34 0.054 AE014134-1221|AAN10613.1| 223|Drosophila melanogaster CG9100-PC... 34 0.054 AE014134-1220|AAN10612.1| 223|Drosophila melanogaster CG9100-PB... 34 0.054 AE014134-1219|AAF52477.1| 223|Drosophila melanogaster CG9100-PA... 34 0.054 AY094795-1|AAM11148.1| 201|Drosophila melanogaster LD21953p pro... 33 0.072 AE014298-2969|AAF45371.1| 201|Drosophila melanogaster CG9575-PA... 33 0.072 AE014298-1530|AAF47981.2| 197|Drosophila melanogaster CG32671-P... 33 0.072 AE014298-1478|AAN09264.1| 197|Drosophila melanogaster CG32673-P... 33 0.072 AY752540-1|AAW31996.1| 195|Drosophila melanogaster CG2885 protein. 33 0.095 AY094697-1|AAM11050.1| 182|Drosophila melanogaster GH10361p pro... 33 0.095 AE014297-281|AAF52005.3| 182|Drosophila melanogaster CG1081-PB,... 33 0.095 AE014297-280|AAF52004.3| 182|Drosophila melanogaster CG1081-PA,... 33 0.095 AY752542-1|AAW31998.1| 195|Drosophila melanogaster CG2885 protein. 32 0.17 AY752539-1|AAW31995.1| 195|Drosophila melanogaster CG2885 protein. 32 0.17 AY752538-1|AAW31994.1| 195|Drosophila melanogaster CG2885 protein. 32 0.17 AY752537-1|AAW31993.1| 195|Drosophila melanogaster CG2885 protein. 32 0.17 AY752536-1|AAW31992.1| 195|Drosophila melanogaster CG2885 protein. 32 0.17 AY752535-1|AAW31991.1| 195|Drosophila melanogaster CG2885 protein. 32 0.17 AY752534-1|AAW31990.1| 195|Drosophila melanogaster CG2885 protein. 32 0.17 AY752533-1|AAW31989.1| 195|Drosophila melanogaster CG2885 protein. 32 0.17 AY071187-1|AAL48809.1| 328|Drosophila melanogaster RE23556p pro... 32 0.17 AE014298-1452|AAF46585.1| 195|Drosophila melanogaster CG2885-PA... 32 0.17 AE014134-1267|AAF52508.1| 328|Drosophila melanogaster CG5160-PA... 32 0.17 BT023110-1|AAY55526.1| 410|Drosophila melanogaster IP08719p pro... 32 0.22 BT023070-1|AAY55486.1| 433|Drosophila melanogaster IP08619p pro... 32 0.22 AY070523-1|AAL47994.1| 217|Drosophila melanogaster GH25818p pro... 32 0.22 AE014296-2503|AAF49642.1| 217|Drosophila melanogaster CG7815-PA... 32 0.22 Y07564-1|CAA68849.1| 264|Drosophila melanogaster RIC (Ras which... 31 0.50 BT024998-1|ABE01228.1| 214|Drosophila melanogaster IP08727p pro... 31 0.50 AY752532-1|AAW31988.1| 174|Drosophila melanogaster CG2532 protein. 31 0.50 AY752531-1|AAW31987.1| 174|Drosophila melanogaster CG2532 protein. 31 0.50 AY752530-1|AAW31986.1| 174|Drosophila melanogaster CG2532 protein. 31 0.50 AY752529-1|AAW31985.1| 174|Drosophila melanogaster CG2532 protein. 31 0.50 AY752528-1|AAW31984.1| 146|Drosophila melanogaster CG2532 protein. 31 0.50 AY752527-1|AAW31983.1| 174|Drosophila melanogaster CG2532 protein. 31 0.50 AY752526-1|AAW31982.1| 174|Drosophila melanogaster CG2532 protein. 31 0.50 AY752525-1|AAW31981.1| 174|Drosophila melanogaster CG2532 protein. 31 0.50 AY752524-1|AAW31980.1| 174|Drosophila melanogaster CG2532 protein. 31 0.50 AY752523-1|AAW31979.1| 174|Drosophila melanogaster CG2532 protein. 31 0.50 AY118407-1|AAM48436.1| 282|Drosophila melanogaster RE62293p pro... 31 0.50 AE014298-1531|AAN09277.1| 214|Drosophila melanogaster CG32670-P... 31 0.50 AE013599-2181|AAF58065.1| 264|Drosophila melanogaster CG8418-PA... 31 0.50 M64621-1|AAA28843.1| 220|Drosophila melanogaster rab3 protein. 30 0.67 D84347-1|BAA21711.1| 207|Drosophila melanogaster rab8 protein. 30 0.67 AY069671-1|AAL39816.1| 207|Drosophila melanogaster LD44762p pro... 30 0.67 AY060449-1|AAL25488.1| 220|Drosophila melanogaster LP05860p pro... 30 0.67 AE014296-3237|AAF49101.1| 207|Drosophila melanogaster CG8287-PA... 30 0.67 AE013599-1159|AAF58762.1| 220|Drosophila melanogaster CG7576-PA... 30 0.67 AB112933-1|BAD07038.1| 207|Drosophila melanogaster Rab8 protein. 30 0.67 AB112932-1|BAD07037.1| 220|Drosophila melanogaster Rab3 protein. 30 0.67 BT003609-1|AAO39612.1| 230|Drosophila melanogaster GH17339p pro... 30 0.88 AY060977-1|AAL28525.1| 230|Drosophila melanogaster GM10914p pro... 30 0.88 AE014298-220|AAF45634.2| 230|Drosophila melanogaster CG14791-PC... 30 0.88 AB112931-1|BAD07036.1| 230|Drosophila melanogaster Rab27 protein. 30 0.88 AY129454-1|AAM76196.1| 280|Drosophila melanogaster RE28276p pro... 29 1.2 AY060425-1|AAL25464.1| 204|Drosophila melanogaster LD39986p pro... 29 1.2 AE014298-3000|AAF50924.1| 204|Drosophila melanogaster CG17060-P... 29 1.2 AE013599-257|AAF57410.3| 280|Drosophila melanogaster CG30158-PA... 29 1.2 AB006189-1|BAA21744.1| 204|Drosophila melanogaster Rab10 protein. 29 1.2 X73219-3|CAA51689.1| 46|Drosophila melanogaster Ras1 protein. 29 1.5 U15967-3|AAB60243.1| 192|Drosophila melanogaster small GTP bind... 29 1.5 M16431-1|AAA28849.1| 195|Drosophila melanogaster protein ( D.me... 29 1.5 M16429-1|AAA28847.1| 189|Drosophila melanogaster protein ( D.me... 29 1.5 M10804-1|AAA99202.1| 195|Drosophila melanogaster ras protein pr... 29 1.5 L38311-1|AAA67042.1| 192|Drosophila melanogaster Rho1 protein. 29 1.5 K01960-1|AAA28846.1| 189|Drosophila melanogaster protein ( D.me... 29 1.5 BT010085-1|AAQ22554.1| 192|Drosophila melanogaster LD03419p pro... 29 1.5 AY119536-1|AAM50190.1| 192|Drosophila melanogaster GH20776p pro... 29 1.5 AY119135-1|AAM50995.1| 192|Drosophila melanogaster RE36103p pro... 29 1.5 AY094888-1|AAM11241.1| 189|Drosophila melanogaster RE53955p pro... 29 1.5 AY089541-1|AAL90279.1| 189|Drosophila melanogaster LD17536p pro... 29 1.5 AY061826-1|AAL27637.1| 388|Drosophila melanogaster GH21984p pro... 29 1.5 AF186648-1|AAF15514.1| 189|Drosophila melanogaster Ras1 protein. 29 1.5 AF177874-1|AAF01186.1| 192|Drosophila melanogaster small GTPase... 29 1.5 AF177873-1|AAF01185.1| 192|Drosophila melanogaster small GTPase... 29 1.5 AF177872-1|AAF01184.1| 192|Drosophila melanogaster small GTPase... 29 1.5 AF177871-1|AAF01183.1| 192|Drosophila melanogaster small GTPase... 29 1.5 AE014297-953|AAF54388.1| 189|Drosophila melanogaster CG9375-PA ... 29 1.5 AE014296-3519|AAF51708.2| 388|Drosophila melanogaster CG7605-PA... 29 1.5 AE014296-774|AAF47845.2| 192|Drosophila melanogaster CG1167-PA ... 29 1.5 AE013599-2180|AAS64844.1| 192|Drosophila melanogaster CG8416-PG... 29 1.5 AE013599-2179|AAS64843.1| 192|Drosophila melanogaster CG8416-PF... 29 1.5 AE013599-2178|AAS64842.1| 192|Drosophila melanogaster CG8416-PE... 29 1.5 AE013599-2177|AAM70946.1| 192|Drosophila melanogaster CG8416-PD... 29 1.5 AE013599-2176|AAM70945.1| 192|Drosophila melanogaster CG8416-PC... 29 1.5 AE013599-2175|AAF58066.1| 192|Drosophila melanogaster CG8416-PB... 29 1.5 AE013599-2174|AAM70944.1| 192|Drosophila melanogaster CG8416-PA... 29 1.5 BT011133-1|AAR82800.1| 780|Drosophila melanogaster HL01056p pro... 29 2.0 AY122142-1|AAM52654.1| 682|Drosophila melanogaster HL02867p pro... 29 2.0 AY071310-1|AAL48932.1| 469|Drosophila melanogaster RE33762p pro... 29 2.0 AY060236-1|AAL25275.1| 207|Drosophila melanogaster GH03685p pro... 29 2.0 AM294833-1|CAL26819.1| 207|Drosophila melanogaster CG5915 protein. 29 2.0 AM294832-1|CAL26818.1| 207|Drosophila melanogaster CG5915 protein. 29 2.0 AM294831-1|CAL26817.1| 207|Drosophila melanogaster CG5915 protein. 29 2.0 AM294830-1|CAL26816.1| 207|Drosophila melanogaster CG5915 protein. 29 2.0 AM294829-1|CAL26815.1| 207|Drosophila melanogaster CG5915 protein. 29 2.0 AM294828-1|CAL26814.1| 207|Drosophila melanogaster CG5915 protein. 29 2.0 AM294827-1|CAL26813.1| 207|Drosophila melanogaster CG5915 protein. 29 2.0 AM294826-1|CAL26812.1| 207|Drosophila melanogaster CG5915 protein. 29 2.0 AM294825-1|CAL26811.1| 207|Drosophila melanogaster CG5915 protein. 29 2.0 AM294824-1|CAL26810.1| 207|Drosophila melanogaster CG5915 protein. 29 2.0 AM294823-1|CAL26809.1| 207|Drosophila melanogaster CG5915 protein. 29 2.0 AF263363-1|AAF73041.1| 207|Drosophila melanogaster small ras-li... 29 2.0 AF079459-1|AAC32270.1| 207|Drosophila melanogaster small ras-li... 29 2.0 AE014298-576|ABC67173.1| 682|Drosophila melanogaster CG32776-PC... 29 2.0 AE014298-575|AAF45905.3| 682|Drosophila melanogaster CG32776-PA... 29 2.0 AE014298-574|ABC67172.1| 1059|Drosophila melanogaster CG32776-PD... 29 2.0 AE014298-573|AAS72338.2| 1058|Drosophila melanogaster CG32776-PB... 29 2.0 AE014297-3431|AAF56218.1| 207|Drosophila melanogaster CG5915-PA... 29 2.0 AE014297-646|AAF54145.2| 469|Drosophila melanogaster CG10086-PA... 29 2.0 AB035672-1|BAA88245.1| 207|Drosophila melanogaster Rab7 protein... 29 2.0 D84348-1|BAA21712.1| 219|Drosophila melanogaster rab-related pr... 28 2.7 AY071400-1|AAL49022.1| 219|Drosophila melanogaster RE48347p pro... 28 2.7 AL031027-5|CAA19844.2| 236|Drosophila melanogaster EG:80H7.4 pr... 28 2.7 AE014298-219|AAF45635.1| 236|Drosophila melanogaster CG14791-PB... 28 2.7 AE014296-1412|AAF50452.1| 219|Drosophila melanogaster CG7062-PA... 28 2.7 BT029985-1|ABM92859.1| 207|Drosophila melanogaster RE30129p pro... 28 3.6 BT003574-1|AAO39578.1| 216|Drosophila melanogaster LD40852p pro... 28 3.6 AY070533-1|AAL48004.1| 216|Drosophila melanogaster GM14354p pro... 28 3.6 AY061398-1|AAL28946.1| 216|Drosophila melanogaster LD32416p pro... 28 3.6 AF233584-1|AAF60289.1| 216|Drosophila melanogaster Ran10A protein. 28 3.6 AF220950-1|AAF30287.1| 216|Drosophila melanogaster GTP-binding ... 28 3.6 AE014298-1568|AAN09287.1| 216|Drosophila melanogaster CG1404-PB... 28 3.6 AE014298-1567|AAF48008.1| 216|Drosophila melanogaster CG1404-PA... 28 3.6 AE014296-1145|AAF50649.2| 207|Drosophila melanogaster CG8519-PA... 28 3.6 BT011477-1|AAR99135.1| 740|Drosophila melanogaster RE10036p pro... 27 4.7 AY752541-1|AAW31997.1| 185|Drosophila melanogaster CG2885 protein. 27 4.7 AE013599-2718|AAF57675.3| 740|Drosophila melanogaster CG15069-P... 27 4.7 X07255-1|CAA30242.1| 29|Drosophila melanogaster protein ( Dros... 27 6.2 U31226-1|AAA79985.1| 410|Drosophila melanogaster head involutio... 27 6.2 AY075188-1|AAL68057.1| 410|Drosophila melanogaster AT13267p pro... 27 6.2 AE014296-3008|AAF49270.1| 410|Drosophila melanogaster CG5123-PA... 27 6.2 BT003654-1|AAO39658.1| 1273|Drosophila melanogaster AT04875p pro... 27 8.2 AY052045-1|AAK93469.1| 427|Drosophila melanogaster LP06017p pro... 27 8.2 AE014298-2455|AAS65390.1| 375|Drosophila melanogaster CG9699-PG... 27 8.2 AE014298-2454|AAN09417.1| 427|Drosophila melanogaster CG9699-PF... 27 8.2 AE014298-2453|AAN09416.1| 427|Drosophila melanogaster CG9699-PE... 27 8.2 AE014298-2452|AAN09415.1| 427|Drosophila melanogaster CG9699-PD... 27 8.2 AE014298-2451|AAF48645.1| 427|Drosophila melanogaster CG9699-PC... 27 8.2 AE014298-2450|AAF48646.1| 427|Drosophila melanogaster CG9699-PB... 27 8.2 AE014298-2449|AAN09414.1| 427|Drosophila melanogaster CG9699-PA... 27 8.2 AE014134-756|AAN10358.4| 23015|Drosophila melanogaster CG33196-P... 27 8.2 >AY081181-1|AAN85553.1| 219|Drosophila melanogaster Rab5 protein. Length = 219 Score = 86.6 bits (205), Expect = 7e-18 Identities = 42/56 (75%), Positives = 44/56 (78%) Frame = +3 Query: 171 TGRDMATNRTGAAQRPNGAPQTKVCQFKLVLLGQSAVGKSSLVLRFVKGQFHESQE 338 T R + TG AQRPNG Q K CQFKLVLLG+SAVGKSSLVLRFVKGQFHE QE Sbjct: 4 TPRSGGASGTGTAQRPNGTSQNKSCQFKLVLLGESAVGKSSLVLRFVKGQFHEYQE 59 >AY081180-1|AAN85552.1| 219|Drosophila melanogaster Rab5 protein. Length = 219 Score = 86.6 bits (205), Expect = 7e-18 Identities = 42/56 (75%), Positives = 44/56 (78%) Frame = +3 Query: 171 TGRDMATNRTGAAQRPNGAPQTKVCQFKLVLLGQSAVGKSSLVLRFVKGQFHESQE 338 T R + TG AQRPNG Q K CQFKLVLLG+SAVGKSSLVLRFVKGQFHE QE Sbjct: 4 TPRSGGASGTGTAQRPNGTSQNKSCQFKLVLLGESAVGKSSLVLRFVKGQFHEYQE 59 >AY060343-1|AAL25382.1| 219|Drosophila melanogaster GH24702p protein. Length = 219 Score = 86.6 bits (205), Expect = 7e-18 Identities = 42/56 (75%), Positives = 44/56 (78%) Frame = +3 Query: 171 TGRDMATNRTGAAQRPNGAPQTKVCQFKLVLLGQSAVGKSSLVLRFVKGQFHESQE 338 T R + TG AQRPNG Q K CQFKLVLLG+SAVGKSSLVLRFVKGQFHE QE Sbjct: 4 TPRSGGASGTGTAQRPNGTSQNKSCQFKLVLLGESAVGKSSLVLRFVKGQFHEYQE 59 >AE014134-396|AAN10426.1| 219|Drosophila melanogaster CG3664-PF, isoform F protein. Length = 219 Score = 86.6 bits (205), Expect = 7e-18 Identities = 42/56 (75%), Positives = 44/56 (78%) Frame = +3 Query: 171 TGRDMATNRTGAAQRPNGAPQTKVCQFKLVLLGQSAVGKSSLVLRFVKGQFHESQE 338 T R + TG AQRPNG Q K CQFKLVLLG+SAVGKSSLVLRFVKGQFHE QE Sbjct: 4 TPRSGGASGTGTAQRPNGTSQNKSCQFKLVLLGESAVGKSSLVLRFVKGQFHEYQE 59 >AE014134-395|AAN10425.1| 219|Drosophila melanogaster CG3664-PE, isoform E protein. Length = 219 Score = 86.6 bits (205), Expect = 7e-18 Identities = 42/56 (75%), Positives = 44/56 (78%) Frame = +3 Query: 171 TGRDMATNRTGAAQRPNGAPQTKVCQFKLVLLGQSAVGKSSLVLRFVKGQFHESQE 338 T R + TG AQRPNG Q K CQFKLVLLG+SAVGKSSLVLRFVKGQFHE QE Sbjct: 4 TPRSGGASGTGTAQRPNGTSQNKSCQFKLVLLGESAVGKSSLVLRFVKGQFHEYQE 59 >AE014134-394|AAN10424.1| 219|Drosophila melanogaster CG3664-PD, isoform D protein. Length = 219 Score = 86.6 bits (205), Expect = 7e-18 Identities = 42/56 (75%), Positives = 44/56 (78%) Frame = +3 Query: 171 TGRDMATNRTGAAQRPNGAPQTKVCQFKLVLLGQSAVGKSSLVLRFVKGQFHESQE 338 T R + TG AQRPNG Q K CQFKLVLLG+SAVGKSSLVLRFVKGQFHE QE Sbjct: 4 TPRSGGASGTGTAQRPNGTSQNKSCQFKLVLLGESAVGKSSLVLRFVKGQFHEYQE 59 >AE014134-393|AAN10423.1| 219|Drosophila melanogaster CG3664-PC, isoform C protein. Length = 219 Score = 86.6 bits (205), Expect = 7e-18 Identities = 42/56 (75%), Positives = 44/56 (78%) Frame = +3 Query: 171 TGRDMATNRTGAAQRPNGAPQTKVCQFKLVLLGQSAVGKSSLVLRFVKGQFHESQE 338 T R + TG AQRPNG Q K CQFKLVLLG+SAVGKSSLVLRFVKGQFHE QE Sbjct: 4 TPRSGGASGTGTAQRPNGTSQNKSCQFKLVLLGESAVGKSSLVLRFVKGQFHEYQE 59 >AE014134-392|AAN10422.1| 219|Drosophila melanogaster CG3664-PB, isoform B protein. Length = 219 Score = 86.6 bits (205), Expect = 7e-18 Identities = 42/56 (75%), Positives = 44/56 (78%) Frame = +3 Query: 171 TGRDMATNRTGAAQRPNGAPQTKVCQFKLVLLGQSAVGKSSLVLRFVKGQFHESQE 338 T R + TG AQRPNG Q K CQFKLVLLG+SAVGKSSLVLRFVKGQFHE QE Sbjct: 4 TPRSGGASGTGTAQRPNGTSQNKSCQFKLVLLGESAVGKSSLVLRFVKGQFHEYQE 59 >AE014134-391|AAF51265.1| 219|Drosophila melanogaster CG3664-PA, isoform A protein. Length = 219 Score = 86.6 bits (205), Expect = 7e-18 Identities = 42/56 (75%), Positives = 44/56 (78%) Frame = +3 Query: 171 TGRDMATNRTGAAQRPNGAPQTKVCQFKLVLLGQSAVGKSSLVLRFVKGQFHESQE 338 T R + TG AQRPNG Q K CQFKLVLLG+SAVGKSSLVLRFVKGQFHE QE Sbjct: 4 TPRSGGASGTGTAQRPNGTSQNKSCQFKLVLLGESAVGKSSLVLRFVKGQFHEYQE 59 >AB035671-1|BAA88244.1| 219|Drosophila melanogaster Rab5 protein protein. Length = 219 Score = 86.6 bits (205), Expect = 7e-18 Identities = 42/56 (75%), Positives = 44/56 (78%) Frame = +3 Query: 171 TGRDMATNRTGAAQRPNGAPQTKVCQFKLVLLGQSAVGKSSLVLRFVKGQFHESQE 338 T R + TG AQRPNG Q K CQFKLVLLG+SAVGKSSLVLRFVKGQFHE QE Sbjct: 4 TPRSGGASGTGTAQRPNGTSQNKSCQFKLVLLGESAVGKSSLVLRFVKGQFHEYQE 59 >AB035353-1|BAA87879.1| 219|Drosophila melanogaster Drab5 protein. Length = 219 Score = 86.6 bits (205), Expect = 7e-18 Identities = 42/56 (75%), Positives = 44/56 (78%) Frame = +3 Query: 171 TGRDMATNRTGAAQRPNGAPQTKVCQFKLVLLGQSAVGKSSLVLRFVKGQFHESQE 338 T R + TG AQRPNG Q K CQFKLVLLG+SAVGKSSLVLRFVKGQFHE QE Sbjct: 4 TPRSGGASGTGTAQRPNGTSQNKSCQFKLVLLGESAVGKSSLVLRFVKGQFHEYQE 59 >BT024201-1|ABC86263.1| 283|Drosophila melanogaster RE46661p protein. Length = 283 Score = 40.3 bits (90), Expect = 6e-04 Identities = 17/28 (60%), Positives = 22/28 (78%) Frame = +3 Query: 249 FKLVLLGQSAVGKSSLVLRFVKGQFHES 332 +++V+ G VGKSSLVLRF+KG F ES Sbjct: 19 YRVVVFGAGGVGKSSLVLRFIKGTFRES 46 >AE014297-1044|AAF54453.1| 233|Drosophila melanogaster CG8500-PA protein. Length = 233 Score = 40.3 bits (90), Expect = 6e-04 Identities = 17/28 (60%), Positives = 22/28 (78%) Frame = +3 Query: 249 FKLVLLGQSAVGKSSLVLRFVKGQFHES 332 +++V+ G VGKSSLVLRF+KG F ES Sbjct: 19 YRVVVFGAGGVGKSSLVLRFIKGTFRES 46 >AE014296-1180|AAF50620.1| 434|Drosophila melanogaster CG8641-PA protein. Length = 434 Score = 37.1 bits (82), Expect = 0.006 Identities = 17/35 (48%), Positives = 24/35 (68%) Frame = +3 Query: 228 PQTKVCQFKLVLLGQSAVGKSSLVLRFVKGQFHES 332 P K C ++LV+LG S GKSS+V RF+ +F E+ Sbjct: 161 PSAKNC-YRLVMLGSSRAGKSSIVARFLGNRFEEA 194 >D84317-1|BAA21710.1| 197|Drosophila melanogaster rab-related protein 4 protein. Length = 197 Score = 36.3 bits (80), Expect = 0.010 Identities = 14/29 (48%), Positives = 24/29 (82%) Frame = +3 Query: 252 KLVLLGQSAVGKSSLVLRFVKGQFHESQE 338 KL+++G+S VGKSSL+ RFV+ +F ++ + Sbjct: 7 KLLVIGESGVGKSSLIRRFVENKFDQNHD 35 >AY075329-1|AAL68196.1| 197|Drosophila melanogaster GH11193p protein. Length = 197 Score = 36.3 bits (80), Expect = 0.010 Identities = 14/29 (48%), Positives = 24/29 (82%) Frame = +3 Query: 252 KLVLLGQSAVGKSSLVLRFVKGQFHESQE 338 KL+++G+S VGKSSL+ RFV+ +F ++ + Sbjct: 7 KLLVIGESGVGKSSLIRRFVENKFDQNHD 35 >AY071340-1|AAL48962.1| 218|Drosophila melanogaster RE37651p protein. Length = 218 Score = 36.3 bits (80), Expect = 0.010 Identities = 16/28 (57%), Positives = 21/28 (75%) Frame = +3 Query: 246 QFKLVLLGQSAVGKSSLVLRFVKGQFHE 329 QF+L+L+G S VGKSSL+ F G+F E Sbjct: 9 QFRLILIGDSTVGKSSLLKFFTDGKFAE 36 >AE014298-1056|AAF46271.1| 218|Drosophila melanogaster CG12156-PA protein. Length = 218 Score = 36.3 bits (80), Expect = 0.010 Identities = 16/28 (57%), Positives = 21/28 (75%) Frame = +3 Query: 246 QFKLVLLGQSAVGKSSLVLRFVKGQFHE 329 QF+L+L+G S VGKSSL+ F G+F E Sbjct: 9 QFRLILIGDSTVGKSSLLKFFTDGKFAE 36 >AE014298-769|AAF46057.1| 197|Drosophila melanogaster CG3129-PA protein. Length = 197 Score = 36.3 bits (80), Expect = 0.010 Identities = 14/29 (48%), Positives = 24/29 (82%) Frame = +3 Query: 252 KLVLLGQSAVGKSSLVLRFVKGQFHESQE 338 KL+++G+S VGKSSL+ RFV+ +F ++ + Sbjct: 7 KLLVIGESGVGKSSLIRRFVENKFDQNHD 35 >AY119634-1|AAM50288.1| 222|Drosophila melanogaster RE42508p protein. Length = 222 Score = 35.9 bits (79), Expect = 0.013 Identities = 15/26 (57%), Positives = 22/26 (84%) Frame = +3 Query: 249 FKLVLLGQSAVGKSSLVLRFVKGQFH 326 FK VLLG+ VGK+SLVLR+++ +F+ Sbjct: 14 FKAVLLGEGCVGKTSLVLRYMEDRFN 39 >AE014298-3235|EAA46055.2| 273|Drosophila melanogaster CG17515-PB, isoform B protein. Length = 273 Score = 35.9 bits (79), Expect = 0.013 Identities = 15/26 (57%), Positives = 22/26 (84%) Frame = +3 Query: 249 FKLVLLGQSAVGKSSLVLRFVKGQFH 326 FK VLLG+ VGK+SLVLR+++ +F+ Sbjct: 65 FKAVLLGEGCVGKTSLVLRYMEDRFN 90 >D84315-1|BAA21708.1| 214|Drosophila melanogaster rab11 protein. Length = 214 Score = 35.1 bits (77), Expect = 0.023 Identities = 14/26 (53%), Positives = 21/26 (80%) Frame = +3 Query: 249 FKLVLLGQSAVGKSSLVLRFVKGQFH 326 FK+VL+G S VGKS+L+ RF + +F+ Sbjct: 12 FKVVLIGDSGVGKSNLLSRFTRNEFN 37 >D84312-1|BAA21705.1| 205|Drosophila melanogaster rab1 protein. Length = 205 Score = 35.1 bits (77), Expect = 0.023 Identities = 16/28 (57%), Positives = 20/28 (71%) Frame = +3 Query: 249 FKLVLLGQSAVGKSSLVLRFVKGQFHES 332 FKL+L+G S VGKS L+LRF + ES Sbjct: 12 FKLLLIGDSGVGKSCLLLRFADDTYTES 39 >BT012453-1|AAS93724.1| 182|Drosophila melanogaster RE63021p protein. Length = 182 Score = 35.1 bits (77), Expect = 0.023 Identities = 15/31 (48%), Positives = 22/31 (70%) Frame = +3 Query: 246 QFKLVLLGQSAVGKSSLVLRFVKGQFHESQE 338 +FK+V+LG VGKS+L ++FV G F E + Sbjct: 3 EFKVVVLGSGGVGKSALTVQFVSGCFIEKYD 33 >BT001785-1|AAN71540.1| 214|Drosophila melanogaster RH21315p protein. Length = 214 Score = 35.1 bits (77), Expect = 0.023 Identities = 14/26 (53%), Positives = 21/26 (80%) Frame = +3 Query: 249 FKLVLLGQSAVGKSSLVLRFVKGQFH 326 FK+VL+G S VGKS+L+ RF + +F+ Sbjct: 12 FKVVLIGDSGVGKSNLLSRFTRNEFN 37 >AY121695-1|AAM52022.1| 101|Drosophila melanogaster RE66843p protein. Length = 101 Score = 35.1 bits (77), Expect = 0.023 Identities = 16/28 (57%), Positives = 20/28 (71%) Frame = +3 Query: 249 FKLVLLGQSAVGKSSLVLRFVKGQFHES 332 FKL+L+G S VGKS L+LRF + ES Sbjct: 12 FKLLLIGDSGVGKSCLLLRFADDTYTES 39 >AY113404-1|AAM29409.1| 214|Drosophila melanogaster RE11886p protein. Length = 214 Score = 35.1 bits (77), Expect = 0.023 Identities = 14/26 (53%), Positives = 21/26 (80%) Frame = +3 Query: 249 FKLVLLGQSAVGKSSLVLRFVKGQFH 326 FK+VL+G S VGKS+L+ RF + +F+ Sbjct: 12 FKVVLIGDSGVGKSNLLSRFTRNEFN 37 >AY070528-1|AAL47999.1| 214|Drosophila melanogaster GM06568p protein. Length = 214 Score = 35.1 bits (77), Expect = 0.023 Identities = 14/26 (53%), Positives = 21/26 (80%) Frame = +3 Query: 249 FKLVLLGQSAVGKSSLVLRFVKGQFH 326 FK+VL+G S VGKS+L+ RF + +F+ Sbjct: 12 FKVVLIGDSGVGKSNLLSRFTRNEFN 37 >AF111427-1|AAC98693.1| 182|Drosophila melanogaster Ras-related protein 2-like protein protein. Length = 182 Score = 35.1 bits (77), Expect = 0.023 Identities = 15/31 (48%), Positives = 22/31 (70%) Frame = +3 Query: 246 QFKLVLLGQSAVGKSSLVLRFVKGQFHESQE 338 +FK+V+LG VGKS+L ++FV G F E + Sbjct: 3 EFKVVVLGSGGVGKSALTVQFVSGCFIEKYD 33 >AE014297-2966|AAN13857.1| 146|Drosophila melanogaster CG3320-PB, isoform B protein. Length = 146 Score = 35.1 bits (77), Expect = 0.023 Identities = 16/28 (57%), Positives = 20/28 (71%) Frame = +3 Query: 249 FKLVLLGQSAVGKSSLVLRFVKGQFHES 332 FKL+L+G S VGKS L+LRF + ES Sbjct: 12 FKLLLIGDSGVGKSCLLLRFADDTYTES 39 >AE014297-2965|AAF55873.1| 205|Drosophila melanogaster CG3320-PA, isoform A protein. Length = 205 Score = 35.1 bits (77), Expect = 0.023 Identities = 16/28 (57%), Positives = 20/28 (71%) Frame = +3 Query: 249 FKLVLLGQSAVGKSSLVLRFVKGQFHES 332 FKL+L+G S VGKS L+LRF + ES Sbjct: 12 FKLLLIGDSGVGKSCLLLRFADDTYTES 39 >AE014297-2931|AAN13849.1| 214|Drosophila melanogaster CG5771-PB, isoform B protein. Length = 214 Score = 35.1 bits (77), Expect = 0.023 Identities = 14/26 (53%), Positives = 21/26 (80%) Frame = +3 Query: 249 FKLVLLGQSAVGKSSLVLRFVKGQFH 326 FK+VL+G S VGKS+L+ RF + +F+ Sbjct: 12 FKVVLIGDSGVGKSNLLSRFTRNEFN 37 >AE014297-2930|AAF55850.1| 214|Drosophila melanogaster CG5771-PA, isoform A protein. Length = 214 Score = 35.1 bits (77), Expect = 0.023 Identities = 14/26 (53%), Positives = 21/26 (80%) Frame = +3 Query: 249 FKLVLLGQSAVGKSSLVLRFVKGQFH 326 FK+VL+G S VGKS+L+ RF + +F+ Sbjct: 12 FKVVLIGDSGVGKSNLLSRFTRNEFN 37 >AE013599-3800|ABC66043.1| 61|Drosophila melanogaster CG3204-PB, isoform B protein. Length = 61 Score = 35.1 bits (77), Expect = 0.023 Identities = 15/31 (48%), Positives = 22/31 (70%) Frame = +3 Query: 246 QFKLVLLGQSAVGKSSLVLRFVKGQFHESQE 338 +FK+V+LG VGKS+L ++FV G F E + Sbjct: 3 EFKVVVLGSGGVGKSALTVQFVSGCFIEKYD 33 >AE013599-3799|AAF47155.1| 182|Drosophila melanogaster CG3204-PA, isoform A protein. Length = 182 Score = 35.1 bits (77), Expect = 0.023 Identities = 15/31 (48%), Positives = 22/31 (70%) Frame = +3 Query: 246 QFKLVLLGQSAVGKSSLVLRFVKGQFHESQE 338 +FK+V+LG VGKS+L ++FV G F E + Sbjct: 3 EFKVVVLGSGGVGKSALTVQFVSGCFIEKYD 33 >AB035354-1|BAA87880.1| 214|Drosophila melanogaster Drab11 protein. Length = 214 Score = 35.1 bits (77), Expect = 0.023 Identities = 14/26 (53%), Positives = 21/26 (80%) Frame = +3 Query: 249 FKLVLLGQSAVGKSSLVLRFVKGQFH 326 FK+VL+G S VGKS+L+ RF + +F+ Sbjct: 12 FKVVLIGDSGVGKSNLLSRFTRNEFN 37 >BT010242-1|AAQ23560.1| 498|Drosophila melanogaster RE48016p protein. Length = 498 Score = 34.7 bits (76), Expect = 0.031 Identities = 19/62 (30%), Positives = 37/62 (59%), Gaps = 1/62 (1%) Frame = +3 Query: 141 QEKVQNGATVTGR-DMATNRTGAAQRPNGAPQTKVCQFKLVLLGQSAVGKSSLVLRFVKG 317 Q+++ A+V+ R +A++R + P P +++++LG AVGKSSLV +F+ Sbjct: 209 QQQLSAPASVSARTSLASSRESSTSNPGNGP------YRVLMLGGPAVGKSSLVSQFMTS 262 Query: 318 QF 323 ++ Sbjct: 263 EY 264 >AE014298-1475|AAF46610.2| 197|Drosophila melanogaster CG9807-PA protein. Length = 197 Score = 34.7 bits (76), Expect = 0.031 Identities = 14/27 (51%), Positives = 20/27 (74%) Frame = +3 Query: 249 FKLVLLGQSAVGKSSLVLRFVKGQFHE 329 FK+++LG S VGK+ L++RF QF E Sbjct: 8 FKIIILGDSGVGKTCLLMRFSDNQFTE 34 >AE013599-2858|AAF57577.1| 537|Drosophila melanogaster CG9811-PA protein. Length = 537 Score = 34.7 bits (76), Expect = 0.031 Identities = 19/62 (30%), Positives = 37/62 (59%), Gaps = 1/62 (1%) Frame = +3 Query: 141 QEKVQNGATVTGR-DMATNRTGAAQRPNGAPQTKVCQFKLVLLGQSAVGKSSLVLRFVKG 317 Q+++ A+V+ R +A++R + P P +++++LG AVGKSSLV +F+ Sbjct: 248 QQQLSAPASVSARTSLASSRESSTSNPGNGP------YRVLMLGGPAVGKSSLVSQFMTS 301 Query: 318 QF 323 ++ Sbjct: 302 EY 303 >D84314-1|BAA21707.1| 208|Drosophila melanogaster rab6 protein. Length = 208 Score = 34.3 bits (75), Expect = 0.041 Identities = 14/31 (45%), Positives = 22/31 (70%) Frame = +3 Query: 246 QFKLVLLGQSAVGKSSLVLRFVKGQFHESQE 338 +FKLV LG+ +VGK+SL+ RF+ F + + Sbjct: 12 KFKLVFLGEQSVGKTSLITRFMYDSFDNTYQ 42 >AY071139-1|AAL48761.1| 256|Drosophila melanogaster RE17845p protein. Length = 256 Score = 34.3 bits (75), Expect = 0.041 Identities = 16/38 (42%), Positives = 23/38 (60%) Frame = +3 Query: 219 NGAPQTKVCQFKLVLLGQSAVGKSSLVLRFVKGQFHES 332 N P K K+V+LG VGKS+L+ RFV ++ E+ Sbjct: 3 NMRPPQKSKLLKVVILGDGGVGKSALLTRFVANRYEEN 40 >AY060261-1|AAL25300.1| 208|Drosophila melanogaster GH09086p protein. Length = 208 Score = 34.3 bits (75), Expect = 0.041 Identities = 14/31 (45%), Positives = 22/31 (70%) Frame = +3 Query: 246 QFKLVLLGQSAVGKSSLVLRFVKGQFHESQE 338 +FKLV LG+ +VGK+SL+ RF+ F + + Sbjct: 12 KFKLVFLGEQSVGKTSLITRFMYDSFDNTYQ 42 >AE014298-1469|AAN09263.1| 197|Drosophila melanogaster CG32678-PA protein. Length = 197 Score = 34.3 bits (75), Expect = 0.041 Identities = 14/25 (56%), Positives = 19/25 (76%) Frame = +3 Query: 249 FKLVLLGQSAVGKSSLVLRFVKGQF 323 FK++LLG S VGK+ L++RF QF Sbjct: 8 FKIILLGDSGVGKTCLLMRFSDNQF 32 >AE014134-3093|AAF53798.1| 256|Drosophila melanogaster CG9994-PA protein. Length = 256 Score = 34.3 bits (75), Expect = 0.041 Identities = 16/38 (42%), Positives = 23/38 (60%) Frame = +3 Query: 219 NGAPQTKVCQFKLVLLGQSAVGKSSLVLRFVKGQFHES 332 N P K K+V+LG VGKS+L+ RFV ++ E+ Sbjct: 3 NMRPPQKSKLLKVVILGDGGVGKSALLTRFVANRYEEN 40 >AE014134-2164|AAF53168.1| 208|Drosophila melanogaster CG6601-PA protein. Length = 208 Score = 34.3 bits (75), Expect = 0.041 Identities = 14/31 (45%), Positives = 22/31 (70%) Frame = +3 Query: 246 QFKLVLLGQSAVGKSSLVLRFVKGQFHESQE 338 +FKLV LG+ +VGK+SL+ RF+ F + + Sbjct: 12 KFKLVFLGEQSVGKTSLITRFMYDSFDNTYQ 42 >AY071080-1|AAL48702.1| 223|Drosophila melanogaster RE14786p protein. Length = 223 Score = 33.9 bits (74), Expect = 0.054 Identities = 15/29 (51%), Positives = 20/29 (68%) Frame = +3 Query: 249 FKLVLLGQSAVGKSSLVLRFVKGQFHESQ 335 FK+VL+G + VGK+ LV RF +G F Q Sbjct: 8 FKIVLVGNAGVGKTCLVRRFTQGLFPPGQ 36 >AE014134-1221|AAN10613.1| 223|Drosophila melanogaster CG9100-PC, isoform C protein. Length = 223 Score = 33.9 bits (74), Expect = 0.054 Identities = 15/29 (51%), Positives = 20/29 (68%) Frame = +3 Query: 249 FKLVLLGQSAVGKSSLVLRFVKGQFHESQ 335 FK+VL+G + VGK+ LV RF +G F Q Sbjct: 8 FKIVLVGNAGVGKTCLVRRFTQGLFPPGQ 36 >AE014134-1220|AAN10612.1| 223|Drosophila melanogaster CG9100-PB, isoform B protein. Length = 223 Score = 33.9 bits (74), Expect = 0.054 Identities = 15/29 (51%), Positives = 20/29 (68%) Frame = +3 Query: 249 FKLVLLGQSAVGKSSLVLRFVKGQFHESQ 335 FK+VL+G + VGK+ LV RF +G F Q Sbjct: 8 FKIVLVGNAGVGKTCLVRRFTQGLFPPGQ 36 >AE014134-1219|AAF52477.1| 223|Drosophila melanogaster CG9100-PA, isoform A protein. Length = 223 Score = 33.9 bits (74), Expect = 0.054 Identities = 15/29 (51%), Positives = 20/29 (68%) Frame = +3 Query: 249 FKLVLLGQSAVGKSSLVLRFVKGQFHESQ 335 FK+VL+G + VGK+ LV RF +G F Q Sbjct: 8 FKIVLVGNAGVGKTCLVRRFTQGLFPPGQ 36 >AY094795-1|AAM11148.1| 201|Drosophila melanogaster LD21953p protein. Length = 201 Score = 33.5 bits (73), Expect = 0.072 Identities = 15/28 (53%), Positives = 20/28 (71%) Frame = +3 Query: 249 FKLVLLGQSAVGKSSLVLRFVKGQFHES 332 FKL+++G S VGKSSL++RF F S Sbjct: 9 FKLLIIGDSGVGKSSLLIRFSDDTFSGS 36 >AE014298-2969|AAF45371.1| 201|Drosophila melanogaster CG9575-PA protein. Length = 201 Score = 33.5 bits (73), Expect = 0.072 Identities = 15/28 (53%), Positives = 20/28 (71%) Frame = +3 Query: 249 FKLVLLGQSAVGKSSLVLRFVKGQFHES 332 FKL+++G S VGKSSL++RF F S Sbjct: 9 FKLLIIGDSGVGKSSLLIRFSDDTFSGS 36 >AE014298-1530|AAF47981.2| 197|Drosophila melanogaster CG32671-PA protein. Length = 197 Score = 33.5 bits (73), Expect = 0.072 Identities = 13/25 (52%), Positives = 19/25 (76%) Frame = +3 Query: 249 FKLVLLGQSAVGKSSLVLRFVKGQF 323 FK+++LG S VGK+ L++RF QF Sbjct: 8 FKIIILGDSGVGKTCLLMRFSDNQF 32 >AE014298-1478|AAN09264.1| 197|Drosophila melanogaster CG32673-PA protein. Length = 197 Score = 33.5 bits (73), Expect = 0.072 Identities = 13/25 (52%), Positives = 19/25 (76%) Frame = +3 Query: 249 FKLVLLGQSAVGKSSLVLRFVKGQF 323 FK+++LG S VGK+ L++RF QF Sbjct: 8 FKIIILGDSGVGKTCLLMRFSDNQF 32 >AY752540-1|AAW31996.1| 195|Drosophila melanogaster CG2885 protein. Length = 195 Score = 33.1 bits (72), Expect = 0.095 Identities = 14/27 (51%), Positives = 20/27 (74%) Frame = +3 Query: 249 FKLVLLGQSAVGKSSLVLRFVKGQFHE 329 FK+++LG S VGKS L++RF +F E Sbjct: 8 FKVIVLGDSGVGKSCLLMRFSDDRFTE 34 >AY094697-1|AAM11050.1| 182|Drosophila melanogaster GH10361p protein. Length = 182 Score = 33.1 bits (72), Expect = 0.095 Identities = 13/28 (46%), Positives = 22/28 (78%) Frame = +3 Query: 255 LVLLGQSAVGKSSLVLRFVKGQFHESQE 338 + ++G +VGKSSL ++FV+GQF +S + Sbjct: 8 IAMMGYRSVGKSSLCIQFVEGQFVDSYD 35 >AE014297-281|AAF52005.3| 182|Drosophila melanogaster CG1081-PB, isoform B protein. Length = 182 Score = 33.1 bits (72), Expect = 0.095 Identities = 13/28 (46%), Positives = 22/28 (78%) Frame = +3 Query: 255 LVLLGQSAVGKSSLVLRFVKGQFHESQE 338 + ++G +VGKSSL ++FV+GQF +S + Sbjct: 8 IAMMGYRSVGKSSLCIQFVEGQFVDSYD 35 >AE014297-280|AAF52004.3| 182|Drosophila melanogaster CG1081-PA, isoform A protein. Length = 182 Score = 33.1 bits (72), Expect = 0.095 Identities = 13/28 (46%), Positives = 22/28 (78%) Frame = +3 Query: 255 LVLLGQSAVGKSSLVLRFVKGQFHESQE 338 + ++G +VGKSSL ++FV+GQF +S + Sbjct: 8 IAMMGYRSVGKSSLCIQFVEGQFVDSYD 35 >AY752542-1|AAW31998.1| 195|Drosophila melanogaster CG2885 protein. Length = 195 Score = 32.3 bits (70), Expect = 0.17 Identities = 14/27 (51%), Positives = 20/27 (74%) Frame = +3 Query: 249 FKLVLLGQSAVGKSSLVLRFVKGQFHE 329 FK+++LG S VGKS L++RF +F E Sbjct: 8 FKVLVLGDSGVGKSCLLMRFSDDRFTE 34 >AY752539-1|AAW31995.1| 195|Drosophila melanogaster CG2885 protein. Length = 195 Score = 32.3 bits (70), Expect = 0.17 Identities = 14/27 (51%), Positives = 20/27 (74%) Frame = +3 Query: 249 FKLVLLGQSAVGKSSLVLRFVKGQFHE 329 FK+++LG S VGKS L++RF +F E Sbjct: 8 FKVLVLGDSGVGKSCLLMRFSDDRFTE 34 >AY752538-1|AAW31994.1| 195|Drosophila melanogaster CG2885 protein. Length = 195 Score = 32.3 bits (70), Expect = 0.17 Identities = 14/27 (51%), Positives = 20/27 (74%) Frame = +3 Query: 249 FKLVLLGQSAVGKSSLVLRFVKGQFHE 329 FK+++LG S VGKS L++RF +F E Sbjct: 8 FKVLVLGDSGVGKSCLLMRFSDDRFTE 34 >AY752537-1|AAW31993.1| 195|Drosophila melanogaster CG2885 protein. Length = 195 Score = 32.3 bits (70), Expect = 0.17 Identities = 14/27 (51%), Positives = 20/27 (74%) Frame = +3 Query: 249 FKLVLLGQSAVGKSSLVLRFVKGQFHE 329 FK+++LG S VGKS L++RF +F E Sbjct: 8 FKVLVLGDSGVGKSCLLMRFSDDRFTE 34 >AY752536-1|AAW31992.1| 195|Drosophila melanogaster CG2885 protein. Length = 195 Score = 32.3 bits (70), Expect = 0.17 Identities = 14/27 (51%), Positives = 20/27 (74%) Frame = +3 Query: 249 FKLVLLGQSAVGKSSLVLRFVKGQFHE 329 FK+++LG S VGKS L++RF +F E Sbjct: 8 FKVLVLGDSGVGKSCLLMRFSDDRFTE 34 >AY752535-1|AAW31991.1| 195|Drosophila melanogaster CG2885 protein. Length = 195 Score = 32.3 bits (70), Expect = 0.17 Identities = 14/27 (51%), Positives = 20/27 (74%) Frame = +3 Query: 249 FKLVLLGQSAVGKSSLVLRFVKGQFHE 329 FK+++LG S VGKS L++RF +F E Sbjct: 8 FKVLVLGDSGVGKSCLLMRFSDDRFTE 34 >AY752534-1|AAW31990.1| 195|Drosophila melanogaster CG2885 protein. Length = 195 Score = 32.3 bits (70), Expect = 0.17 Identities = 14/27 (51%), Positives = 20/27 (74%) Frame = +3 Query: 249 FKLVLLGQSAVGKSSLVLRFVKGQFHE 329 FK+++LG S VGKS L++RF +F E Sbjct: 8 FKVLVLGDSGVGKSCLLMRFSDDRFTE 34 >AY752533-1|AAW31989.1| 195|Drosophila melanogaster CG2885 protein. Length = 195 Score = 32.3 bits (70), Expect = 0.17 Identities = 14/27 (51%), Positives = 20/27 (74%) Frame = +3 Query: 249 FKLVLLGQSAVGKSSLVLRFVKGQFHE 329 FK+++LG S VGKS L++RF +F E Sbjct: 8 FKVLVLGDSGVGKSCLLMRFSDDRFTE 34 >AY071187-1|AAL48809.1| 328|Drosophila melanogaster RE23556p protein. Length = 328 Score = 32.3 bits (70), Expect = 0.17 Identities = 14/34 (41%), Positives = 23/34 (67%) Frame = +3 Query: 222 GAPQTKVCQFKLVLLGQSAVGKSSLVLRFVKGQF 323 G K K+++LGQS VGK+++V+RF+ +F Sbjct: 14 GLHTNKQKTLKVMVLGQSGVGKTAMVVRFITRRF 47 >AE014298-1452|AAF46585.1| 195|Drosophila melanogaster CG2885-PA protein. Length = 195 Score = 32.3 bits (70), Expect = 0.17 Identities = 14/27 (51%), Positives = 20/27 (74%) Frame = +3 Query: 249 FKLVLLGQSAVGKSSLVLRFVKGQFHE 329 FK+++LG S VGKS L++RF +F E Sbjct: 8 FKVLVLGDSGVGKSCLLMRFSDDRFTE 34 >AE014134-1267|AAF52508.1| 328|Drosophila melanogaster CG5160-PA protein. Length = 328 Score = 32.3 bits (70), Expect = 0.17 Identities = 14/34 (41%), Positives = 23/34 (67%) Frame = +3 Query: 222 GAPQTKVCQFKLVLLGQSAVGKSSLVLRFVKGQF 323 G K K+++LGQS VGK+++V+RF+ +F Sbjct: 14 GLHTNKQKTLKVMVLGQSGVGKTAMVVRFITRRF 47 >BT023110-1|AAY55526.1| 410|Drosophila melanogaster IP08719p protein. Length = 410 Score = 31.9 bits (69), Expect = 0.22 Identities = 12/24 (50%), Positives = 20/24 (83%) Frame = +3 Query: 252 KLVLLGQSAVGKSSLVLRFVKGQF 323 K+++LG S VGK+SL++RF G++ Sbjct: 214 KVIMLGDSGVGKTSLLIRFRDGRY 237 >BT023070-1|AAY55486.1| 433|Drosophila melanogaster IP08619p protein. Length = 433 Score = 31.9 bits (69), Expect = 0.22 Identities = 12/24 (50%), Positives = 20/24 (83%) Frame = +3 Query: 252 KLVLLGQSAVGKSSLVLRFVKGQF 323 K+++LG S VGK+SL++RF G++ Sbjct: 237 KVIMLGDSGVGKTSLLIRFRDGRY 260 >AY070523-1|AAL47994.1| 217|Drosophila melanogaster GH25818p protein. Length = 217 Score = 31.9 bits (69), Expect = 0.22 Identities = 15/33 (45%), Positives = 22/33 (66%), Gaps = 1/33 (3%) Frame = +3 Query: 228 PQTKV-CQFKLVLLGQSAVGKSSLVLRFVKGQF 323 PQ +V FKL+L+G GK++LV R + G+F Sbjct: 3 PQEEVKAIFKLILIGDGGTGKTTLVKRHLTGEF 35 >AE014296-2503|AAF49642.1| 217|Drosophila melanogaster CG7815-PA protein. Length = 217 Score = 31.9 bits (69), Expect = 0.22 Identities = 15/33 (45%), Positives = 22/33 (66%), Gaps = 1/33 (3%) Frame = +3 Query: 228 PQTKV-CQFKLVLLGQSAVGKSSLVLRFVKGQF 323 PQ +V FKL+L+G GK++LV R + G+F Sbjct: 3 PQEEVKAIFKLILIGDGGTGKTTLVKRHLTGEF 35 >Y07564-1|CAA68849.1| 264|Drosophila melanogaster RIC (Ras which interacts withCalmodulin) protein. Length = 264 Score = 30.7 bits (66), Expect = 0.50 Identities = 12/25 (48%), Positives = 18/25 (72%) Frame = +3 Query: 249 FKLVLLGQSAVGKSSLVLRFVKGQF 323 +K+V+LG VGKS++ L+FV F Sbjct: 60 YKIVILGDGGVGKSAVTLQFVSHSF 84 >BT024998-1|ABE01228.1| 214|Drosophila melanogaster IP08727p protein. Length = 214 Score = 30.7 bits (66), Expect = 0.50 Identities = 13/27 (48%), Positives = 19/27 (70%) Frame = +3 Query: 249 FKLVLLGQSAVGKSSLVLRFVKGQFHE 329 FK+++LG VGKS L++RF +F E Sbjct: 8 FKILVLGDIGVGKSCLLMRFSDNRFTE 34 >AY752532-1|AAW31988.1| 174|Drosophila melanogaster CG2532 protein. Length = 174 Score = 30.7 bits (66), Expect = 0.50 Identities = 13/27 (48%), Positives = 19/27 (70%) Frame = +3 Query: 249 FKLVLLGQSAVGKSSLVLRFVKGQFHE 329 FK+++LG VGKS L++RF +F E Sbjct: 8 FKILVLGDIGVGKSCLLMRFSDNRFTE 34 >AY752531-1|AAW31987.1| 174|Drosophila melanogaster CG2532 protein. Length = 174 Score = 30.7 bits (66), Expect = 0.50 Identities = 13/27 (48%), Positives = 19/27 (70%) Frame = +3 Query: 249 FKLVLLGQSAVGKSSLVLRFVKGQFHE 329 FK+++LG VGKS L++RF +F E Sbjct: 8 FKILVLGDIGVGKSCLLMRFSDNRFTE 34 >AY752530-1|AAW31986.1| 174|Drosophila melanogaster CG2532 protein. Length = 174 Score = 30.7 bits (66), Expect = 0.50 Identities = 13/27 (48%), Positives = 19/27 (70%) Frame = +3 Query: 249 FKLVLLGQSAVGKSSLVLRFVKGQFHE 329 FK+++LG VGKS L++RF +F E Sbjct: 8 FKILVLGDIGVGKSCLLMRFSDNRFTE 34 >AY752529-1|AAW31985.1| 174|Drosophila melanogaster CG2532 protein. Length = 174 Score = 30.7 bits (66), Expect = 0.50 Identities = 13/27 (48%), Positives = 19/27 (70%) Frame = +3 Query: 249 FKLVLLGQSAVGKSSLVLRFVKGQFHE 329 FK+++LG VGKS L++RF +F E Sbjct: 8 FKILVLGDIGVGKSCLLMRFSDNRFTE 34 >AY752528-1|AAW31984.1| 146|Drosophila melanogaster CG2532 protein. Length = 146 Score = 30.7 bits (66), Expect = 0.50 Identities = 13/27 (48%), Positives = 19/27 (70%) Frame = +3 Query: 249 FKLVLLGQSAVGKSSLVLRFVKGQFHE 329 FK+++LG VGKS L++RF +F E Sbjct: 8 FKILVLGDIGVGKSCLLMRFSDNRFTE 34 >AY752527-1|AAW31983.1| 174|Drosophila melanogaster CG2532 protein. Length = 174 Score = 30.7 bits (66), Expect = 0.50 Identities = 13/27 (48%), Positives = 19/27 (70%) Frame = +3 Query: 249 FKLVLLGQSAVGKSSLVLRFVKGQFHE 329 FK+++LG VGKS L++RF +F E Sbjct: 8 FKILVLGDIGVGKSCLLMRFSDNRFTE 34 >AY752526-1|AAW31982.1| 174|Drosophila melanogaster CG2532 protein. Length = 174 Score = 30.7 bits (66), Expect = 0.50 Identities = 13/27 (48%), Positives = 19/27 (70%) Frame = +3 Query: 249 FKLVLLGQSAVGKSSLVLRFVKGQFHE 329 FK+++LG VGKS L++RF +F E Sbjct: 8 FKILVLGDIGVGKSCLLMRFSDNRFTE 34 >AY752525-1|AAW31981.1| 174|Drosophila melanogaster CG2532 protein. Length = 174 Score = 30.7 bits (66), Expect = 0.50 Identities = 13/27 (48%), Positives = 19/27 (70%) Frame = +3 Query: 249 FKLVLLGQSAVGKSSLVLRFVKGQFHE 329 FK+++LG VGKS L++RF +F E Sbjct: 8 FKILVLGDIGVGKSCLLMRFSDNRFTE 34 >AY752524-1|AAW31980.1| 174|Drosophila melanogaster CG2532 protein. Length = 174 Score = 30.7 bits (66), Expect = 0.50 Identities = 13/27 (48%), Positives = 19/27 (70%) Frame = +3 Query: 249 FKLVLLGQSAVGKSSLVLRFVKGQFHE 329 FK+++LG VGKS L++RF +F E Sbjct: 8 FKILVLGDIGVGKSCLLMRFSDNRFTE 34 >AY752523-1|AAW31979.1| 174|Drosophila melanogaster CG2532 protein. Length = 174 Score = 30.7 bits (66), Expect = 0.50 Identities = 13/27 (48%), Positives = 19/27 (70%) Frame = +3 Query: 249 FKLVLLGQSAVGKSSLVLRFVKGQFHE 329 FK+++LG VGKS L++RF +F E Sbjct: 8 FKILVLGDIGVGKSCLLMRFSDNRFTE 34 >AY118407-1|AAM48436.1| 282|Drosophila melanogaster RE62293p protein. Length = 282 Score = 30.7 bits (66), Expect = 0.50 Identities = 12/25 (48%), Positives = 18/25 (72%) Frame = +3 Query: 249 FKLVLLGQSAVGKSSLVLRFVKGQF 323 +K+V+LG VGKS++ L+FV F Sbjct: 60 YKIVILGDGGVGKSAVTLQFVSHSF 84 >AE014298-1531|AAN09277.1| 214|Drosophila melanogaster CG32670-PA protein. Length = 214 Score = 30.7 bits (66), Expect = 0.50 Identities = 13/27 (48%), Positives = 19/27 (70%) Frame = +3 Query: 249 FKLVLLGQSAVGKSSLVLRFVKGQFHE 329 FK+++LG VGKS L++RF +F E Sbjct: 8 FKILVLGDIGVGKSCLLMRFSDNRFTE 34 >AE013599-2181|AAF58065.1| 264|Drosophila melanogaster CG8418-PA protein. Length = 264 Score = 30.7 bits (66), Expect = 0.50 Identities = 12/25 (48%), Positives = 18/25 (72%) Frame = +3 Query: 249 FKLVLLGQSAVGKSSLVLRFVKGQF 323 +K+V+LG VGKS++ L+FV F Sbjct: 60 YKIVILGDGGVGKSAVTLQFVSHSF 84 >M64621-1|AAA28843.1| 220|Drosophila melanogaster rab3 protein. Length = 220 Score = 30.3 bits (65), Expect = 0.67 Identities = 13/35 (37%), Positives = 21/35 (60%) Frame = +3 Query: 219 NGAPQTKVCQFKLVLLGQSAVGKSSLVLRFVKGQF 323 + A Q FKL+++G S+VGK+S + R+ F Sbjct: 12 DAADQNFDYMFKLLIIGNSSVGKTSFLFRYADDSF 46 >D84347-1|BAA21711.1| 207|Drosophila melanogaster rab8 protein. Length = 207 Score = 30.3 bits (65), Expect = 0.67 Identities = 12/26 (46%), Positives = 19/26 (73%) Frame = +3 Query: 249 FKLVLLGQSAVGKSSLVLRFVKGQFH 326 FKL+L+G S VGK+ ++ RF + F+ Sbjct: 9 FKLLLIGDSGVGKTCILFRFSEDAFN 34 >AY069671-1|AAL39816.1| 207|Drosophila melanogaster LD44762p protein. Length = 207 Score = 30.3 bits (65), Expect = 0.67 Identities = 12/26 (46%), Positives = 19/26 (73%) Frame = +3 Query: 249 FKLVLLGQSAVGKSSLVLRFVKGQFH 326 FKL+L+G S VGK+ ++ RF + F+ Sbjct: 9 FKLLLIGDSGVGKTCILFRFSEDAFN 34 >AY060449-1|AAL25488.1| 220|Drosophila melanogaster LP05860p protein. Length = 220 Score = 30.3 bits (65), Expect = 0.67 Identities = 13/35 (37%), Positives = 21/35 (60%) Frame = +3 Query: 219 NGAPQTKVCQFKLVLLGQSAVGKSSLVLRFVKGQF 323 + A Q FKL+++G S+VGK+S + R+ F Sbjct: 12 DAADQNFDYMFKLLIIGNSSVGKTSFLFRYADDSF 46 >AE014296-3237|AAF49101.1| 207|Drosophila melanogaster CG8287-PA protein. Length = 207 Score = 30.3 bits (65), Expect = 0.67 Identities = 12/26 (46%), Positives = 19/26 (73%) Frame = +3 Query: 249 FKLVLLGQSAVGKSSLVLRFVKGQFH 326 FKL+L+G S VGK+ ++ RF + F+ Sbjct: 9 FKLLLIGDSGVGKTCILFRFSEDAFN 34 >AE013599-1159|AAF58762.1| 220|Drosophila melanogaster CG7576-PA protein. Length = 220 Score = 30.3 bits (65), Expect = 0.67 Identities = 13/35 (37%), Positives = 21/35 (60%) Frame = +3 Query: 219 NGAPQTKVCQFKLVLLGQSAVGKSSLVLRFVKGQF 323 + A Q FKL+++G S+VGK+S + R+ F Sbjct: 12 DAADQNFDYMFKLLIIGNSSVGKTSFLFRYADDSF 46 >AB112933-1|BAD07038.1| 207|Drosophila melanogaster Rab8 protein. Length = 207 Score = 30.3 bits (65), Expect = 0.67 Identities = 12/26 (46%), Positives = 19/26 (73%) Frame = +3 Query: 249 FKLVLLGQSAVGKSSLVLRFVKGQFH 326 FKL+L+G S VGK+ ++ RF + F+ Sbjct: 9 FKLLLIGDSGVGKTCILFRFSEDAFN 34 >AB112932-1|BAD07037.1| 220|Drosophila melanogaster Rab3 protein. Length = 220 Score = 30.3 bits (65), Expect = 0.67 Identities = 13/35 (37%), Positives = 21/35 (60%) Frame = +3 Query: 219 NGAPQTKVCQFKLVLLGQSAVGKSSLVLRFVKGQF 323 + A Q FKL+++G S+VGK+S + R+ F Sbjct: 12 DAADQNFDYMFKLLIIGNSSVGKTSFLFRYADDSF 46 >BT003609-1|AAO39612.1| 230|Drosophila melanogaster GH17339p protein. Length = 230 Score = 29.9 bits (64), Expect = 0.88 Identities = 11/25 (44%), Positives = 18/25 (72%) Frame = +3 Query: 252 KLVLLGQSAVGKSSLVLRFVKGQFH 326 K ++LG S VGK+ L+ ++ G+FH Sbjct: 13 KFLVLGDSGVGKTCLLYQYTDGRFH 37 >AY060977-1|AAL28525.1| 230|Drosophila melanogaster GM10914p protein. Length = 230 Score = 29.9 bits (64), Expect = 0.88 Identities = 11/25 (44%), Positives = 18/25 (72%) Frame = +3 Query: 252 KLVLLGQSAVGKSSLVLRFVKGQFH 326 K ++LG S VGK+ L+ ++ G+FH Sbjct: 13 KFLVLGDSGVGKTCLLYQYTDGRFH 37 >AE014298-220|AAF45634.2| 230|Drosophila melanogaster CG14791-PC, isoform C protein. Length = 230 Score = 29.9 bits (64), Expect = 0.88 Identities = 11/25 (44%), Positives = 18/25 (72%) Frame = +3 Query: 252 KLVLLGQSAVGKSSLVLRFVKGQFH 326 K ++LG S VGK+ L+ ++ G+FH Sbjct: 13 KFLVLGDSGVGKTCLLYQYTDGRFH 37 >AB112931-1|BAD07036.1| 230|Drosophila melanogaster Rab27 protein. Length = 230 Score = 29.9 bits (64), Expect = 0.88 Identities = 11/25 (44%), Positives = 18/25 (72%) Frame = +3 Query: 252 KLVLLGQSAVGKSSLVLRFVKGQFH 326 K ++LG S VGK+ L+ ++ G+FH Sbjct: 13 KFLVLGDSGVGKTCLLYQYTDGRFH 37 >AY129454-1|AAM76196.1| 280|Drosophila melanogaster RE28276p protein. Length = 280 Score = 29.5 bits (63), Expect = 1.2 Identities = 13/22 (59%), Positives = 18/22 (81%) Frame = +3 Query: 246 QFKLVLLGQSAVGKSSLVLRFV 311 + +LVLLG + VGKSS+V RF+ Sbjct: 6 RIRLVLLGGTGVGKSSIVKRFL 27 >AY060425-1|AAL25464.1| 204|Drosophila melanogaster LD39986p protein. Length = 204 Score = 29.5 bits (63), Expect = 1.2 Identities = 14/33 (42%), Positives = 20/33 (60%) Frame = +3 Query: 225 APQTKVCQFKLVLLGQSAVGKSSLVLRFVKGQF 323 A +T FKL+L+G S VGK+ ++ RF F Sbjct: 2 AKKTYDLLFKLLLIGDSGVGKTCILFRFSDDAF 34 >AE014298-3000|AAF50924.1| 204|Drosophila melanogaster CG17060-PA protein. Length = 204 Score = 29.5 bits (63), Expect = 1.2 Identities = 14/33 (42%), Positives = 20/33 (60%) Frame = +3 Query: 225 APQTKVCQFKLVLLGQSAVGKSSLVLRFVKGQF 323 A +T FKL+L+G S VGK+ ++ RF F Sbjct: 2 AKKTYDLLFKLLLIGDSGVGKTCILFRFSDDAF 34 >AE013599-257|AAF57410.3| 280|Drosophila melanogaster CG30158-PA protein. Length = 280 Score = 29.5 bits (63), Expect = 1.2 Identities = 13/22 (59%), Positives = 18/22 (81%) Frame = +3 Query: 246 QFKLVLLGQSAVGKSSLVLRFV 311 + +LVLLG + VGKSS+V RF+ Sbjct: 6 RIRLVLLGGAGVGKSSIVKRFL 27 >AB006189-1|BAA21744.1| 204|Drosophila melanogaster Rab10 protein. Length = 204 Score = 29.5 bits (63), Expect = 1.2 Identities = 14/33 (42%), Positives = 20/33 (60%) Frame = +3 Query: 225 APQTKVCQFKLVLLGQSAVGKSSLVLRFVKGQF 323 A +T FKL+L+G S VGK+ ++ RF F Sbjct: 2 AKKTYDLLFKLLLIGDSGVGKTCILFRFSDDAF 34 >X73219-3|CAA51689.1| 46|Drosophila melanogaster Ras1 protein. Length = 46 Score = 29.1 bits (62), Expect = 1.5 Identities = 10/26 (38%), Positives = 19/26 (73%) Frame = +3 Query: 246 QFKLVLLGQSAVGKSSLVLRFVKGQF 323 ++KLV++G VGKS+L ++ ++ F Sbjct: 3 EYKLVVVGAGGVGKSALTIQLIQNHF 28 >U15967-3|AAB60243.1| 192|Drosophila melanogaster small GTP binding protein protein. Length = 192 Score = 29.1 bits (62), Expect = 1.5 Identities = 10/25 (40%), Positives = 19/25 (76%) Frame = +3 Query: 249 FKLVLLGQSAVGKSSLVLRFVKGQF 323 +KLV++G VGKS++ ++F++ F Sbjct: 6 YKLVVVGGGGVGKSAITIQFIQSYF 30 >M16431-1|AAA28849.1| 195|Drosophila melanogaster protein ( D.melanogaster (Dmras64B)Dras2 gene, exon 3. ). Length = 195 Score = 29.1 bits (62), Expect = 1.5 Identities = 10/25 (40%), Positives = 19/25 (76%) Frame = +3 Query: 249 FKLVLLGQSAVGKSSLVLRFVKGQF 323 +KLV++G VGKS++ ++F++ F Sbjct: 6 YKLVVVGGGGVGKSAITIQFIQSYF 30 >M16429-1|AAA28847.1| 189|Drosophila melanogaster protein ( D.melanogaster Dmras85Dgene, exon 3. ). Length = 189 Score = 29.1 bits (62), Expect = 1.5 Identities = 10/26 (38%), Positives = 19/26 (73%) Frame = +3 Query: 246 QFKLVLLGQSAVGKSSLVLRFVKGQF 323 ++KLV++G VGKS+L ++ ++ F Sbjct: 3 EYKLVVVGAGGVGKSALTIQLIQNHF 28 >M10804-1|AAA99202.1| 195|Drosophila melanogaster ras protein protein. Length = 195 Score = 29.1 bits (62), Expect = 1.5 Identities = 10/25 (40%), Positives = 19/25 (76%) Frame = +3 Query: 249 FKLVLLGQSAVGKSSLVLRFVKGQF 323 +KLV++G VGKS++ ++F++ F Sbjct: 6 YKLVVVGGGGVGKSAITIQFIQSYF 30 >L38311-1|AAA67042.1| 192|Drosophila melanogaster Rho1 protein. Length = 192 Score = 29.1 bits (62), Expect = 1.5 Identities = 13/26 (50%), Positives = 18/26 (69%) Frame = +3 Query: 252 KLVLLGQSAVGKSSLVLRFVKGQFHE 329 KLV++G A GK+ L++ F K QF E Sbjct: 7 KLVIVGDGACGKTCLLIVFSKDQFPE 32 >K01960-1|AAA28846.1| 189|Drosophila melanogaster protein ( D.melanogaster chromosome3 locus 85D Dras1 gene, complete. ). Length = 189 Score = 29.1 bits (62), Expect = 1.5 Identities = 10/26 (38%), Positives = 19/26 (73%) Frame = +3 Query: 246 QFKLVLLGQSAVGKSSLVLRFVKGQF 323 ++KLV++G VGKS+L ++ ++ F Sbjct: 3 EYKLVVVGPGGVGKSALTIQLIQNHF 28 >BT010085-1|AAQ22554.1| 192|Drosophila melanogaster LD03419p protein. Length = 192 Score = 29.1 bits (62), Expect = 1.5 Identities = 13/26 (50%), Positives = 18/26 (69%) Frame = +3 Query: 252 KLVLLGQSAVGKSSLVLRFVKGQFHE 329 KLV++G A GK+ L++ F K QF E Sbjct: 7 KLVIVGDGACGKTCLLIVFSKDQFPE 32 >AY119536-1|AAM50190.1| 192|Drosophila melanogaster GH20776p protein. Length = 192 Score = 29.1 bits (62), Expect = 1.5 Identities = 13/26 (50%), Positives = 18/26 (69%) Frame = +3 Query: 252 KLVLLGQSAVGKSSLVLRFVKGQFHE 329 KLV++G A GK+ L++ F K QF E Sbjct: 7 KLVIVGDGACGKTCLLIVFSKDQFPE 32 >AY119135-1|AAM50995.1| 192|Drosophila melanogaster RE36103p protein. Length = 192 Score = 29.1 bits (62), Expect = 1.5 Identities = 10/25 (40%), Positives = 19/25 (76%) Frame = +3 Query: 249 FKLVLLGQSAVGKSSLVLRFVKGQF 323 +KLV++G VGKS++ ++F++ F Sbjct: 6 YKLVVVGGGGVGKSAITIQFIQSYF 30 >AY094888-1|AAM11241.1| 189|Drosophila melanogaster RE53955p protein. Length = 189 Score = 29.1 bits (62), Expect = 1.5 Identities = 10/26 (38%), Positives = 19/26 (73%) Frame = +3 Query: 246 QFKLVLLGQSAVGKSSLVLRFVKGQF 323 ++KLV++G VGKS+L ++ ++ F Sbjct: 3 EYKLVVVGAGGVGKSALTIQLIQNHF 28 >AY089541-1|AAL90279.1| 189|Drosophila melanogaster LD17536p protein. Length = 189 Score = 29.1 bits (62), Expect = 1.5 Identities = 10/26 (38%), Positives = 19/26 (73%) Frame = +3 Query: 246 QFKLVLLGQSAVGKSSLVLRFVKGQF 323 ++KLV++G VGKS+L ++ ++ F Sbjct: 3 EYKLVVVGAGGVGKSALTIQLIQNHF 28 >AY061826-1|AAL27637.1| 388|Drosophila melanogaster GH21984p protein. Length = 388 Score = 29.1 bits (62), Expect = 1.5 Identities = 11/24 (45%), Positives = 18/24 (75%) Frame = +3 Query: 252 KLVLLGQSAVGKSSLVLRFVKGQF 323 K +LLG S VGK+S ++++ G+F Sbjct: 192 KTILLGDSGVGKTSFLVKYNTGEF 215 >AF186648-1|AAF15514.1| 189|Drosophila melanogaster Ras1 protein. Length = 189 Score = 29.1 bits (62), Expect = 1.5 Identities = 10/26 (38%), Positives = 19/26 (73%) Frame = +3 Query: 246 QFKLVLLGQSAVGKSSLVLRFVKGQF 323 ++KLV++G VGKS+L ++ ++ F Sbjct: 3 EYKLVVVGAGGVGKSALTIQLIQNHF 28 >AF177874-1|AAF01186.1| 192|Drosophila melanogaster small GTPase RHO1 protein. Length = 192 Score = 29.1 bits (62), Expect = 1.5 Identities = 13/26 (50%), Positives = 18/26 (69%) Frame = +3 Query: 252 KLVLLGQSAVGKSSLVLRFVKGQFHE 329 KLV++G A GK+ L++ F K QF E Sbjct: 7 KLVIVGDGACGKTCLLIVFSKDQFPE 32 >AF177873-1|AAF01185.1| 192|Drosophila melanogaster small GTPase RHO1 protein. Length = 192 Score = 29.1 bits (62), Expect = 1.5 Identities = 13/26 (50%), Positives = 18/26 (69%) Frame = +3 Query: 252 KLVLLGQSAVGKSSLVLRFVKGQFHE 329 KLV++G A GK+ L++ F K QF E Sbjct: 7 KLVIVGDGACGKTCLLIVFSKDQFPE 32 >AF177872-1|AAF01184.1| 192|Drosophila melanogaster small GTPase RHO1 protein. Length = 192 Score = 29.1 bits (62), Expect = 1.5 Identities = 13/26 (50%), Positives = 18/26 (69%) Frame = +3 Query: 252 KLVLLGQSAVGKSSLVLRFVKGQFHE 329 KLV++G A GK+ L++ F K QF E Sbjct: 7 KLVIVGDGACGKTCLLIVFSKDQFPE 32 >AF177871-1|AAF01183.1| 192|Drosophila melanogaster small GTPase RHO1 protein. Length = 192 Score = 29.1 bits (62), Expect = 1.5 Identities = 13/26 (50%), Positives = 18/26 (69%) Frame = +3 Query: 252 KLVLLGQSAVGKSSLVLRFVKGQFHE 329 KLV++G A GK+ L++ F K QF E Sbjct: 7 KLVIVGDGACGKTCLLIVFSKDQFPE 32 >AE014297-953|AAF54388.1| 189|Drosophila melanogaster CG9375-PA protein. Length = 189 Score = 29.1 bits (62), Expect = 1.5 Identities = 10/26 (38%), Positives = 19/26 (73%) Frame = +3 Query: 246 QFKLVLLGQSAVGKSSLVLRFVKGQF 323 ++KLV++G VGKS+L ++ ++ F Sbjct: 3 EYKLVVVGAGGVGKSALTIQLIQNHF 28 >AE014296-3519|AAF51708.2| 388|Drosophila melanogaster CG7605-PA protein. Length = 388 Score = 29.1 bits (62), Expect = 1.5 Identities = 11/24 (45%), Positives = 18/24 (75%) Frame = +3 Query: 252 KLVLLGQSAVGKSSLVLRFVKGQF 323 K +LLG S VGK+S ++++ G+F Sbjct: 192 KTILLGDSGVGKTSFLVKYNTGEF 215 >AE014296-774|AAF47845.2| 192|Drosophila melanogaster CG1167-PA protein. Length = 192 Score = 29.1 bits (62), Expect = 1.5 Identities = 10/25 (40%), Positives = 19/25 (76%) Frame = +3 Query: 249 FKLVLLGQSAVGKSSLVLRFVKGQF 323 +KLV++G VGKS++ ++F++ F Sbjct: 6 YKLVVVGGGGVGKSAITIQFIQSYF 30 >AE013599-2180|AAS64844.1| 192|Drosophila melanogaster CG8416-PG, isoform G protein. Length = 192 Score = 29.1 bits (62), Expect = 1.5 Identities = 13/26 (50%), Positives = 18/26 (69%) Frame = +3 Query: 252 KLVLLGQSAVGKSSLVLRFVKGQFHE 329 KLV++G A GK+ L++ F K QF E Sbjct: 7 KLVIVGDGACGKTCLLIVFSKDQFPE 32 >AE013599-2179|AAS64843.1| 192|Drosophila melanogaster CG8416-PF, isoform F protein. Length = 192 Score = 29.1 bits (62), Expect = 1.5 Identities = 13/26 (50%), Positives = 18/26 (69%) Frame = +3 Query: 252 KLVLLGQSAVGKSSLVLRFVKGQFHE 329 KLV++G A GK+ L++ F K QF E Sbjct: 7 KLVIVGDGACGKTCLLIVFSKDQFPE 32 >AE013599-2178|AAS64842.1| 192|Drosophila melanogaster CG8416-PE, isoform E protein. Length = 192 Score = 29.1 bits (62), Expect = 1.5 Identities = 13/26 (50%), Positives = 18/26 (69%) Frame = +3 Query: 252 KLVLLGQSAVGKSSLVLRFVKGQFHE 329 KLV++G A GK+ L++ F K QF E Sbjct: 7 KLVIVGDGACGKTCLLIVFSKDQFPE 32 >AE013599-2177|AAM70946.1| 192|Drosophila melanogaster CG8416-PD, isoform D protein. Length = 192 Score = 29.1 bits (62), Expect = 1.5 Identities = 13/26 (50%), Positives = 18/26 (69%) Frame = +3 Query: 252 KLVLLGQSAVGKSSLVLRFVKGQFHE 329 KLV++G A GK+ L++ F K QF E Sbjct: 7 KLVIVGDGACGKTCLLIVFSKDQFPE 32 >AE013599-2176|AAM70945.1| 192|Drosophila melanogaster CG8416-PC, isoform C protein. Length = 192 Score = 29.1 bits (62), Expect = 1.5 Identities = 13/26 (50%), Positives = 18/26 (69%) Frame = +3 Query: 252 KLVLLGQSAVGKSSLVLRFVKGQFHE 329 KLV++G A GK+ L++ F K QF E Sbjct: 7 KLVIVGDGACGKTCLLIVFSKDQFPE 32 >AE013599-2175|AAF58066.1| 192|Drosophila melanogaster CG8416-PB, isoform B protein. Length = 192 Score = 29.1 bits (62), Expect = 1.5 Identities = 13/26 (50%), Positives = 18/26 (69%) Frame = +3 Query: 252 KLVLLGQSAVGKSSLVLRFVKGQFHE 329 KLV++G A GK+ L++ F K QF E Sbjct: 7 KLVIVGDGACGKTCLLIVFSKDQFPE 32 >AE013599-2174|AAM70944.1| 192|Drosophila melanogaster CG8416-PA, isoform A protein. Length = 192 Score = 29.1 bits (62), Expect = 1.5 Identities = 13/26 (50%), Positives = 18/26 (69%) Frame = +3 Query: 252 KLVLLGQSAVGKSSLVLRFVKGQFHE 329 KLV++G A GK+ L++ F K QF E Sbjct: 7 KLVIVGDGACGKTCLLIVFSKDQFPE 32 >BT011133-1|AAR82800.1| 780|Drosophila melanogaster HL01056p protein. Length = 780 Score = 28.7 bits (61), Expect = 2.0 Identities = 24/77 (31%), Positives = 40/77 (51%), Gaps = 3/77 (3%) Frame = +3 Query: 102 NFGVTATS*RSVAQEKVQN-GATVTGRDMA-TNRTGAAQRP-NGAPQTKVCQFKLVLLGQ 272 N G + S RS + V + G + +G D +N +GA+ +G P V +K+ +LG Sbjct: 320 NLGDSLRSRRSRSINSVTSTGTSNSGVDRHNSNASGASGEVIDGDPN--VPAYKIAMLGA 377 Query: 273 SAVGKSSLVLRFVKGQF 323 S VGK++L +F + Sbjct: 378 SGVGKTTLTYQFTTSDY 394 >AY122142-1|AAM52654.1| 682|Drosophila melanogaster HL02867p protein. Length = 682 Score = 28.7 bits (61), Expect = 2.0 Identities = 24/77 (31%), Positives = 40/77 (51%), Gaps = 3/77 (3%) Frame = +3 Query: 102 NFGVTATS*RSVAQEKVQN-GATVTGRDMA-TNRTGAAQRP-NGAPQTKVCQFKLVLLGQ 272 N G + S RS + V + G + +G D +N +GA+ +G P V +K+ +LG Sbjct: 222 NLGDSLRSRRSRSINSVTSTGTSNSGVDRHNSNASGASGEVIDGDPN--VPAYKIAMLGA 279 Query: 273 SAVGKSSLVLRFVKGQF 323 S VGK++L +F + Sbjct: 280 SGVGKTTLTYQFTTSDY 296 >AY071310-1|AAL48932.1| 469|Drosophila melanogaster RE33762p protein. Length = 469 Score = 28.7 bits (61), Expect = 2.0 Identities = 13/26 (50%), Positives = 15/26 (57%) Frame = +2 Query: 107 RCHGDFVKICRPRKSSERSYSDREGY 184 R HG V I P+K S+ YS RE Y Sbjct: 55 RRHGKAVAIQNPKKRSKHQYSGREDY 80 >AY060236-1|AAL25275.1| 207|Drosophila melanogaster GH03685p protein. Length = 207 Score = 28.7 bits (61), Expect = 2.0 Identities = 11/24 (45%), Positives = 20/24 (83%) Frame = +3 Query: 252 KLVLLGQSAVGKSSLVLRFVKGQF 323 K+++LG S+VGK+SL+ ++V +F Sbjct: 10 KVIILGDSSVGKTSLMNQYVNKRF 33 >AM294833-1|CAL26819.1| 207|Drosophila melanogaster CG5915 protein. Length = 207 Score = 28.7 bits (61), Expect = 2.0 Identities = 11/24 (45%), Positives = 20/24 (83%) Frame = +3 Query: 252 KLVLLGQSAVGKSSLVLRFVKGQF 323 K+++LG S+VGK+SL+ ++V +F Sbjct: 10 KVIILGDSSVGKTSLMNQYVNKRF 33 >AM294832-1|CAL26818.1| 207|Drosophila melanogaster CG5915 protein. Length = 207 Score = 28.7 bits (61), Expect = 2.0 Identities = 11/24 (45%), Positives = 20/24 (83%) Frame = +3 Query: 252 KLVLLGQSAVGKSSLVLRFVKGQF 323 K+++LG S+VGK+SL+ ++V +F Sbjct: 10 KVIILGDSSVGKTSLMNQYVNKRF 33 >AM294831-1|CAL26817.1| 207|Drosophila melanogaster CG5915 protein. Length = 207 Score = 28.7 bits (61), Expect = 2.0 Identities = 11/24 (45%), Positives = 20/24 (83%) Frame = +3 Query: 252 KLVLLGQSAVGKSSLVLRFVKGQF 323 K+++LG S+VGK+SL+ ++V +F Sbjct: 10 KVIILGDSSVGKTSLMNQYVNKRF 33 >AM294830-1|CAL26816.1| 207|Drosophila melanogaster CG5915 protein. Length = 207 Score = 28.7 bits (61), Expect = 2.0 Identities = 11/24 (45%), Positives = 20/24 (83%) Frame = +3 Query: 252 KLVLLGQSAVGKSSLVLRFVKGQF 323 K+++LG S+VGK+SL+ ++V +F Sbjct: 10 KVIILGDSSVGKTSLMNQYVNKRF 33 >AM294829-1|CAL26815.1| 207|Drosophila melanogaster CG5915 protein. Length = 207 Score = 28.7 bits (61), Expect = 2.0 Identities = 11/24 (45%), Positives = 20/24 (83%) Frame = +3 Query: 252 KLVLLGQSAVGKSSLVLRFVKGQF 323 K+++LG S+VGK+SL+ ++V +F Sbjct: 10 KVIILGDSSVGKTSLMNQYVNKRF 33 >AM294828-1|CAL26814.1| 207|Drosophila melanogaster CG5915 protein. Length = 207 Score = 28.7 bits (61), Expect = 2.0 Identities = 11/24 (45%), Positives = 20/24 (83%) Frame = +3 Query: 252 KLVLLGQSAVGKSSLVLRFVKGQF 323 K+++LG S+VGK+SL+ ++V +F Sbjct: 10 KVIILGDSSVGKTSLMNQYVNKRF 33 >AM294827-1|CAL26813.1| 207|Drosophila melanogaster CG5915 protein. Length = 207 Score = 28.7 bits (61), Expect = 2.0 Identities = 11/24 (45%), Positives = 20/24 (83%) Frame = +3 Query: 252 KLVLLGQSAVGKSSLVLRFVKGQF 323 K+++LG S+VGK+SL+ ++V +F Sbjct: 10 KVIILGDSSVGKTSLMNQYVNKRF 33 >AM294826-1|CAL26812.1| 207|Drosophila melanogaster CG5915 protein. Length = 207 Score = 28.7 bits (61), Expect = 2.0 Identities = 11/24 (45%), Positives = 20/24 (83%) Frame = +3 Query: 252 KLVLLGQSAVGKSSLVLRFVKGQF 323 K+++LG S+VGK+SL+ ++V +F Sbjct: 10 KVIILGDSSVGKTSLMNQYVNKRF 33 >AM294825-1|CAL26811.1| 207|Drosophila melanogaster CG5915 protein. Length = 207 Score = 28.7 bits (61), Expect = 2.0 Identities = 11/24 (45%), Positives = 20/24 (83%) Frame = +3 Query: 252 KLVLLGQSAVGKSSLVLRFVKGQF 323 K+++LG S+VGK+SL+ ++V +F Sbjct: 10 KVIILGDSSVGKTSLMNQYVNKRF 33 >AM294824-1|CAL26810.1| 207|Drosophila melanogaster CG5915 protein. Length = 207 Score = 28.7 bits (61), Expect = 2.0 Identities = 11/24 (45%), Positives = 20/24 (83%) Frame = +3 Query: 252 KLVLLGQSAVGKSSLVLRFVKGQF 323 K+++LG S+VGK+SL+ ++V +F Sbjct: 10 KVIILGDSSVGKTSLMNQYVNKRF 33 >AM294823-1|CAL26809.1| 207|Drosophila melanogaster CG5915 protein. Length = 207 Score = 28.7 bits (61), Expect = 2.0 Identities = 11/24 (45%), Positives = 20/24 (83%) Frame = +3 Query: 252 KLVLLGQSAVGKSSLVLRFVKGQF 323 K+++LG S+VGK+SL+ ++V +F Sbjct: 10 KVIILGDSSVGKTSLMNQYVNKRF 33 >AF263363-1|AAF73041.1| 207|Drosophila melanogaster small ras-like GTPase RAB7 protein. Length = 207 Score = 28.7 bits (61), Expect = 2.0 Identities = 11/24 (45%), Positives = 20/24 (83%) Frame = +3 Query: 252 KLVLLGQSAVGKSSLVLRFVKGQF 323 K+++LG S+VGK+SL+ ++V +F Sbjct: 10 KVIILGDSSVGKTSLMNQYVNKRF 33 >AF079459-1|AAC32270.1| 207|Drosophila melanogaster small ras-like GTPase protein. Length = 207 Score = 28.7 bits (61), Expect = 2.0 Identities = 11/24 (45%), Positives = 20/24 (83%) Frame = +3 Query: 252 KLVLLGQSAVGKSSLVLRFVKGQF 323 K+++LG S+VGK+SL+ ++V +F Sbjct: 10 KVIILGDSSVGKTSLMNQYVNKRF 33 >AE014298-576|ABC67173.1| 682|Drosophila melanogaster CG32776-PC, isoform C protein. Length = 682 Score = 28.7 bits (61), Expect = 2.0 Identities = 24/77 (31%), Positives = 40/77 (51%), Gaps = 3/77 (3%) Frame = +3 Query: 102 NFGVTATS*RSVAQEKVQN-GATVTGRDMA-TNRTGAAQRP-NGAPQTKVCQFKLVLLGQ 272 N G + S RS + V + G + +G D +N +GA+ +G P V +K+ +LG Sbjct: 222 NLGDSLRSRRSRSINSVTSTGTSNSGVDRHNSNASGASGEVIDGDPN--VPAYKIAMLGA 279 Query: 273 SAVGKSSLVLRFVKGQF 323 S VGK++L +F + Sbjct: 280 SGVGKTTLTYQFTTSDY 296 >AE014298-575|AAF45905.3| 682|Drosophila melanogaster CG32776-PA, isoform A protein. Length = 682 Score = 28.7 bits (61), Expect = 2.0 Identities = 24/77 (31%), Positives = 40/77 (51%), Gaps = 3/77 (3%) Frame = +3 Query: 102 NFGVTATS*RSVAQEKVQN-GATVTGRDMA-TNRTGAAQRP-NGAPQTKVCQFKLVLLGQ 272 N G + S RS + V + G + +G D +N +GA+ +G P V +K+ +LG Sbjct: 222 NLGDSLRSRRSRSINSVTSTGTSNSGVDRHNSNASGASGEVIDGDPN--VPAYKIAMLGA 279 Query: 273 SAVGKSSLVLRFVKGQF 323 S VGK++L +F + Sbjct: 280 SGVGKTTLTYQFTTSDY 296 >AE014298-574|ABC67172.1| 1059|Drosophila melanogaster CG32776-PD, isoform D protein. Length = 1059 Score = 28.7 bits (61), Expect = 2.0 Identities = 24/77 (31%), Positives = 40/77 (51%), Gaps = 3/77 (3%) Frame = +3 Query: 102 NFGVTATS*RSVAQEKVQN-GATVTGRDMA-TNRTGAAQRP-NGAPQTKVCQFKLVLLGQ 272 N G + S RS + V + G + +G D +N +GA+ +G P V +K+ +LG Sbjct: 599 NLGDSLRSRRSRSINSVTSTGTSNSGVDRHNSNASGASGEVIDGDPN--VPAYKIAMLGA 656 Query: 273 SAVGKSSLVLRFVKGQF 323 S VGK++L +F + Sbjct: 657 SGVGKTTLTYQFTTSDY 673 >AE014298-573|AAS72338.2| 1058|Drosophila melanogaster CG32776-PB, isoform B protein. Length = 1058 Score = 28.7 bits (61), Expect = 2.0 Identities = 24/77 (31%), Positives = 40/77 (51%), Gaps = 3/77 (3%) Frame = +3 Query: 102 NFGVTATS*RSVAQEKVQN-GATVTGRDMA-TNRTGAAQRP-NGAPQTKVCQFKLVLLGQ 272 N G + S RS + V + G + +G D +N +GA+ +G P V +K+ +LG Sbjct: 598 NLGDSLRSRRSRSINSVTSTGTSNSGVDRHNSNASGASGEVIDGDPN--VPAYKIAMLGA 655 Query: 273 SAVGKSSLVLRFVKGQF 323 S VGK++L +F + Sbjct: 656 SGVGKTTLTYQFTTSDY 672 >AE014297-3431|AAF56218.1| 207|Drosophila melanogaster CG5915-PA protein. Length = 207 Score = 28.7 bits (61), Expect = 2.0 Identities = 11/24 (45%), Positives = 20/24 (83%) Frame = +3 Query: 252 KLVLLGQSAVGKSSLVLRFVKGQF 323 K+++LG S+VGK+SL+ ++V +F Sbjct: 10 KVIILGDSSVGKTSLMNQYVNKRF 33 >AE014297-646|AAF54145.2| 469|Drosophila melanogaster CG10086-PA protein. Length = 469 Score = 28.7 bits (61), Expect = 2.0 Identities = 13/26 (50%), Positives = 15/26 (57%) Frame = +2 Query: 107 RCHGDFVKICRPRKSSERSYSDREGY 184 R HG V I P+K S+ YS RE Y Sbjct: 55 RRHGKAVAIQNPKKRSKHQYSGREDY 80 >AB035672-1|BAA88245.1| 207|Drosophila melanogaster Rab7 protein protein. Length = 207 Score = 28.7 bits (61), Expect = 2.0 Identities = 11/24 (45%), Positives = 20/24 (83%) Frame = +3 Query: 252 KLVLLGQSAVGKSSLVLRFVKGQF 323 K+++LG S+VGK+SL+ ++V +F Sbjct: 10 KVIILGDSSVGKTSLMNQYVNKRF 33 >D84348-1|BAA21712.1| 219|Drosophila melanogaster rab-related protein 3 protein. Length = 219 Score = 28.3 bits (60), Expect = 2.7 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = +3 Query: 249 FKLVLLGQSAVGKSSLVLRFVKGQFHE 329 FK+VL+G GK+ +V RF G + E Sbjct: 22 FKIVLIGDCGTGKTCIVDRFKTGNYIE 48 >AY071400-1|AAL49022.1| 219|Drosophila melanogaster RE48347p protein. Length = 219 Score = 28.3 bits (60), Expect = 2.7 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = +3 Query: 249 FKLVLLGQSAVGKSSLVLRFVKGQFHE 329 FK+VL+G GK+ +V RF G + E Sbjct: 22 FKIVLIGDCGTGKTCIVDRFKTGNYIE 48 >AL031027-5|CAA19844.2| 236|Drosophila melanogaster EG:80H7.4 protein. Length = 236 Score = 28.3 bits (60), Expect = 2.7 Identities = 10/25 (40%), Positives = 18/25 (72%) Frame = +3 Query: 252 KLVLLGQSAVGKSSLVLRFVKGQFH 326 + ++LG S VGK+ L+ ++ G+FH Sbjct: 19 QFLVLGDSGVGKTCLLYQYTDGRFH 43 >AE014298-219|AAF45635.1| 236|Drosophila melanogaster CG14791-PB, isoform B protein. Length = 236 Score = 28.3 bits (60), Expect = 2.7 Identities = 10/25 (40%), Positives = 18/25 (72%) Frame = +3 Query: 252 KLVLLGQSAVGKSSLVLRFVKGQFH 326 + ++LG S VGK+ L+ ++ G+FH Sbjct: 19 QFLVLGDSGVGKTCLLYQYTDGRFH 43 >AE014296-1412|AAF50452.1| 219|Drosophila melanogaster CG7062-PA protein. Length = 219 Score = 28.3 bits (60), Expect = 2.7 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = +3 Query: 249 FKLVLLGQSAVGKSSLVLRFVKGQFHE 329 FK+VL+G GK+ +V RF G + E Sbjct: 22 FKIVLIGDCGTGKTCIVDRFKTGNYIE 48 >BT029985-1|ABM92859.1| 207|Drosophila melanogaster RE30129p protein. Length = 207 Score = 27.9 bits (59), Expect = 3.6 Identities = 9/31 (29%), Positives = 23/31 (74%) Frame = +3 Query: 231 QTKVCQFKLVLLGQSAVGKSSLVLRFVKGQF 323 ++ + + K+ ++G +VGKS+L++RF+ ++ Sbjct: 10 KSTLTELKIAVIGAPSVGKSALIVRFLTKRY 40 >BT003574-1|AAO39578.1| 216|Drosophila melanogaster LD40852p protein. Length = 216 Score = 27.9 bits (59), Expect = 3.6 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = +3 Query: 249 FKLVLLGQSAVGKSSLVLRFVKGQFHE 329 FK VL+G GK++ V R + G+F + Sbjct: 11 FKCVLVGDGGTGKTTFVKRHMTGEFEK 37 >AY070533-1|AAL48004.1| 216|Drosophila melanogaster GM14354p protein. Length = 216 Score = 27.9 bits (59), Expect = 3.6 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = +3 Query: 249 FKLVLLGQSAVGKSSLVLRFVKGQFHE 329 FK VL+G GK++ V R + G+F + Sbjct: 11 FKCVLVGDGGTGKTTFVKRHMTGEFEK 37 >AY061398-1|AAL28946.1| 216|Drosophila melanogaster LD32416p protein. Length = 216 Score = 27.9 bits (59), Expect = 3.6 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = +3 Query: 249 FKLVLLGQSAVGKSSLVLRFVKGQFHE 329 FK VL+G GK++ V R + G+F + Sbjct: 11 FKCVLVGDGGTGKTTFVKRHMTGEFEK 37 >AF233584-1|AAF60289.1| 216|Drosophila melanogaster Ran10A protein. Length = 216 Score = 27.9 bits (59), Expect = 3.6 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = +3 Query: 249 FKLVLLGQSAVGKSSLVLRFVKGQFHE 329 FK VL+G GK++ V R + G+F + Sbjct: 11 FKCVLVGDGGTGKTTFVKRHMTGEFEK 37 >AF220950-1|AAF30287.1| 216|Drosophila melanogaster GTP-binding nuclear protein RAN protein. Length = 216 Score = 27.9 bits (59), Expect = 3.6 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = +3 Query: 249 FKLVLLGQSAVGKSSLVLRFVKGQFHE 329 FK VL+G GK++ V R + G+F + Sbjct: 11 FKCVLVGDGGTGKTTFVKRHMTGEFEK 37 >AE014298-1568|AAN09287.1| 216|Drosophila melanogaster CG1404-PB, isoform B protein. Length = 216 Score = 27.9 bits (59), Expect = 3.6 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = +3 Query: 249 FKLVLLGQSAVGKSSLVLRFVKGQFHE 329 FK VL+G GK++ V R + G+F + Sbjct: 11 FKCVLVGDGGTGKTTFVKRHMTGEFEK 37 >AE014298-1567|AAF48008.1| 216|Drosophila melanogaster CG1404-PA, isoform A protein. Length = 216 Score = 27.9 bits (59), Expect = 3.6 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = +3 Query: 249 FKLVLLGQSAVGKSSLVLRFVKGQFHE 329 FK VL+G GK++ V R + G+F + Sbjct: 11 FKCVLVGDGGTGKTTFVKRHMTGEFEK 37 >AE014296-1145|AAF50649.2| 207|Drosophila melanogaster CG8519-PA protein. Length = 207 Score = 27.9 bits (59), Expect = 3.6 Identities = 9/31 (29%), Positives = 23/31 (74%) Frame = +3 Query: 231 QTKVCQFKLVLLGQSAVGKSSLVLRFVKGQF 323 ++ + + K+ ++G +VGKS+L++RF+ ++ Sbjct: 10 KSTLTELKIAVIGAPSVGKSALIVRFLTKRY 40 >BT011477-1|AAR99135.1| 740|Drosophila melanogaster RE10036p protein. Length = 740 Score = 27.5 bits (58), Expect = 4.7 Identities = 9/26 (34%), Positives = 21/26 (80%) Frame = +3 Query: 246 QFKLVLLGQSAVGKSSLVLRFVKGQF 323 ++++V+LG + VGK++LV +F+ ++ Sbjct: 526 RYRVVMLGDAGVGKTALVNQFMTSEY 551 >AY752541-1|AAW31997.1| 185|Drosophila melanogaster CG2885 protein. Length = 185 Score = 27.5 bits (58), Expect = 4.7 Identities = 12/24 (50%), Positives = 17/24 (70%) Frame = +3 Query: 258 VLLGQSAVGKSSLVLRFVKGQFHE 329 ++LG S VGKS L++RF +F E Sbjct: 1 LVLGDSGVGKSCLLMRFSDDRFTE 24 >AE013599-2718|AAF57675.3| 740|Drosophila melanogaster CG15069-PA, isoform A protein. Length = 740 Score = 27.5 bits (58), Expect = 4.7 Identities = 9/26 (34%), Positives = 21/26 (80%) Frame = +3 Query: 246 QFKLVLLGQSAVGKSSLVLRFVKGQF 323 ++++V+LG + VGK++LV +F+ ++ Sbjct: 526 RYRVVMLGDAGVGKTALVNQFMTSEY 551 >X07255-1|CAA30242.1| 29|Drosophila melanogaster protein ( Drosophila ras2 promoter. ). Length = 29 Score = 27.1 bits (57), Expect = 6.2 Identities = 9/22 (40%), Positives = 18/22 (81%) Frame = +3 Query: 249 FKLVLLGQSAVGKSSLVLRFVK 314 +KLV++G VGKS++ ++F++ Sbjct: 6 YKLVVVGGGGVGKSAITIQFIQ 27 >U31226-1|AAA79985.1| 410|Drosophila melanogaster head involution defective protein protein. Length = 410 Score = 27.1 bits (57), Expect = 6.2 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = -1 Query: 63 RKCKTGKSRTEIQNDHEQTW 4 R TG+ E Q+DHE TW Sbjct: 282 RLTSTGEDEREYQSDHEATW 301 >AY075188-1|AAL68057.1| 410|Drosophila melanogaster AT13267p protein. Length = 410 Score = 27.1 bits (57), Expect = 6.2 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = -1 Query: 63 RKCKTGKSRTEIQNDHEQTW 4 R TG+ E Q+DHE TW Sbjct: 282 RLTSTGEDEREYQSDHEATW 301 >AE014296-3008|AAF49270.1| 410|Drosophila melanogaster CG5123-PA protein. Length = 410 Score = 27.1 bits (57), Expect = 6.2 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = -1 Query: 63 RKCKTGKSRTEIQNDHEQTW 4 R TG+ E Q+DHE TW Sbjct: 282 RLTSTGEDEREYQSDHEATW 301 >BT003654-1|AAO39658.1| 1273|Drosophila melanogaster AT04875p protein. Length = 1273 Score = 26.6 bits (56), Expect = 8.2 Identities = 14/46 (30%), Positives = 22/46 (47%) Frame = -2 Query: 212 LCGSGPVCRHIPPCHCSSVLNFFLGDRSSRSRRDTEIIINYTLKQI 75 +C V PP H S L +L ++SRS R +++ T Q+ Sbjct: 216 ICDQEMVQAKDPPSHYLSKLRTYLDPKASRSHRKRKMVGESTSTQV 261 >AY052045-1|AAK93469.1| 427|Drosophila melanogaster LP06017p protein. Length = 427 Score = 26.6 bits (56), Expect = 8.2 Identities = 9/31 (29%), Positives = 22/31 (70%) Frame = +3 Query: 246 QFKLVLLGQSAVGKSSLVLRFVKGQFHESQE 338 +F L+++G+S +GKS+L+ G +++++ Sbjct: 85 EFTLMVVGESGLGKSTLINSLFLGDLYKNRQ 115 >AE014298-2455|AAS65390.1| 375|Drosophila melanogaster CG9699-PG, isoform G protein. Length = 375 Score = 26.6 bits (56), Expect = 8.2 Identities = 9/31 (29%), Positives = 22/31 (70%) Frame = +3 Query: 246 QFKLVLLGQSAVGKSSLVLRFVKGQFHESQE 338 +F L+++G+S +GKS+L+ G +++++ Sbjct: 33 EFTLMVVGESGLGKSTLINSLFLGDLYKNRQ 63 >AE014298-2454|AAN09417.1| 427|Drosophila melanogaster CG9699-PF, isoform F protein. Length = 427 Score = 26.6 bits (56), Expect = 8.2 Identities = 9/31 (29%), Positives = 22/31 (70%) Frame = +3 Query: 246 QFKLVLLGQSAVGKSSLVLRFVKGQFHESQE 338 +F L+++G+S +GKS+L+ G +++++ Sbjct: 85 EFTLMVVGESGLGKSTLINSLFLGDLYKNRQ 115 >AE014298-2453|AAN09416.1| 427|Drosophila melanogaster CG9699-PE, isoform E protein. Length = 427 Score = 26.6 bits (56), Expect = 8.2 Identities = 9/31 (29%), Positives = 22/31 (70%) Frame = +3 Query: 246 QFKLVLLGQSAVGKSSLVLRFVKGQFHESQE 338 +F L+++G+S +GKS+L+ G +++++ Sbjct: 85 EFTLMVVGESGLGKSTLINSLFLGDLYKNRQ 115 >AE014298-2452|AAN09415.1| 427|Drosophila melanogaster CG9699-PD, isoform D protein. Length = 427 Score = 26.6 bits (56), Expect = 8.2 Identities = 9/31 (29%), Positives = 22/31 (70%) Frame = +3 Query: 246 QFKLVLLGQSAVGKSSLVLRFVKGQFHESQE 338 +F L+++G+S +GKS+L+ G +++++ Sbjct: 85 EFTLMVVGESGLGKSTLINSLFLGDLYKNRQ 115 >AE014298-2451|AAF48645.1| 427|Drosophila melanogaster CG9699-PC, isoform C protein. Length = 427 Score = 26.6 bits (56), Expect = 8.2 Identities = 9/31 (29%), Positives = 22/31 (70%) Frame = +3 Query: 246 QFKLVLLGQSAVGKSSLVLRFVKGQFHESQE 338 +F L+++G+S +GKS+L+ G +++++ Sbjct: 85 EFTLMVVGESGLGKSTLINSLFLGDLYKNRQ 115 >AE014298-2450|AAF48646.1| 427|Drosophila melanogaster CG9699-PB, isoform B protein. Length = 427 Score = 26.6 bits (56), Expect = 8.2 Identities = 9/31 (29%), Positives = 22/31 (70%) Frame = +3 Query: 246 QFKLVLLGQSAVGKSSLVLRFVKGQFHESQE 338 +F L+++G+S +GKS+L+ G +++++ Sbjct: 85 EFTLMVVGESGLGKSTLINSLFLGDLYKNRQ 115 >AE014298-2449|AAN09414.1| 427|Drosophila melanogaster CG9699-PA, isoform A protein. Length = 427 Score = 26.6 bits (56), Expect = 8.2 Identities = 9/31 (29%), Positives = 22/31 (70%) Frame = +3 Query: 246 QFKLVLLGQSAVGKSSLVLRFVKGQFHESQE 338 +F L+++G+S +GKS+L+ G +++++ Sbjct: 85 EFTLMVVGESGLGKSTLINSLFLGDLYKNRQ 115 >AE014134-756|AAN10358.4| 23015|Drosophila melanogaster CG33196-PB protein. Length = 23015 Score = 26.6 bits (56), Expect = 8.2 Identities = 12/29 (41%), Positives = 16/29 (55%), Gaps = 3/29 (10%) Frame = -2 Query: 212 LCGSGPVCR---HIPPCHCSSVLNFFLGD 135 +C +CR H+P CHC N F+GD Sbjct: 16746 VCALNALCRVINHLPTCHCQ---NGFVGD 16771 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,601,225 Number of Sequences: 53049 Number of extensions: 312086 Number of successful extensions: 1401 Number of sequences better than 10.0: 187 Number of HSP's better than 10.0 without gapping: 1381 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1399 length of database: 24,988,368 effective HSP length: 75 effective length of database: 21,009,693 effective search space used: 777358641 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -