BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0611 (734 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EU008544-1|ABS31131.1| 493|Tribolium castaneum cytochrome P450 ... 23 2.6 AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosin... 23 2.6 AM295014-1|CAL25729.1| 407|Tribolium castaneum ultraspiracle nu... 23 2.6 AM292380-1|CAL23192.2| 489|Tribolium castaneum gustatory recept... 23 3.4 DQ659251-1|ABG47449.1| 366|Tribolium castaneum chitinase 11 pro... 21 7.8 >EU008544-1|ABS31131.1| 493|Tribolium castaneum cytochrome P450 protein. Length = 493 Score = 23.0 bits (47), Expect = 2.6 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = +3 Query: 255 STYLLNVKRTTANSQELASVLR 320 S YL+NV +TT +E ++R Sbjct: 239 SDYLINVFKTTLQEREKKKIIR 260 >AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosine kinase Torso-likeprotein protein. Length = 803 Score = 23.0 bits (47), Expect = 2.6 Identities = 9/31 (29%), Positives = 15/31 (48%) Frame = +2 Query: 593 WTSTSLMPPLTLSHIIQWLPHPLNRNALLLN 685 W+ L+P ++H I P N+ + LN Sbjct: 294 WSKPDLIPNYYIAHFINIDPENHNKTEIFLN 324 >AM295014-1|CAL25729.1| 407|Tribolium castaneum ultraspiracle nuclear receptor protein. Length = 407 Score = 23.0 bits (47), Expect = 2.6 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = +3 Query: 315 LRTIGKKLSRHVFFF 359 LR+IG K H+FFF Sbjct: 371 LRSIGLKCLEHLFFF 385 >AM292380-1|CAL23192.2| 489|Tribolium castaneum gustatory receptor candidate 59 protein. Length = 489 Score = 22.6 bits (46), Expect = 3.4 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = -2 Query: 301 SCELAVVLLTFNKYVLSFMLN 239 +CEL V+L + + L+FML+ Sbjct: 135 TCELFFVILLWISFFLNFMLH 155 >DQ659251-1|ABG47449.1| 366|Tribolium castaneum chitinase 11 protein. Length = 366 Score = 21.4 bits (43), Expect = 7.8 Identities = 8/22 (36%), Positives = 13/22 (59%) Frame = -3 Query: 630 LKVSGGINDVDVHGRRLLLNTK 565 LK+ N++D+HG + N K Sbjct: 69 LKILDSWNEIDLHGLENVANLK 90 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 173,464 Number of Sequences: 336 Number of extensions: 3916 Number of successful extensions: 10 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19675845 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -