Bombyx BLAST Result against arabidopsis

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ceN-0611
         (734 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At4g23540.1 68417.m03392 expressed protein probable membrane pro...    28   5.6  
At5g35080.1 68418.m04151 expressed protein                             27   9.8  

>At4g23540.1 68417.m03392 expressed protein probable membrane
           protein YPL012w, Saccharomyces cerevisiae, PIR2:S59681
          Length = 675

 Score = 28.3 bits (60), Expect = 5.6
 Identities = 13/34 (38%), Positives = 19/34 (55%)
 Frame = -2

Query: 343 LLSFLPIVLRTEASSCELAVVLLTFNKYVLSFML 242
           LL+ LPI L  E+ SC  A ++    KY++   L
Sbjct: 30  LLTLLPITLHAESHSCTNAWLIPILRKYIIGASL 63


>At5g35080.1 68418.m04151 expressed protein
          Length = 282

 Score = 27.5 bits (58), Expect = 9.8
 Identities = 7/11 (63%), Positives = 10/11 (90%)
 Frame = +3

Query: 495 WWHYKFCNQKF 527
           WW Y+FC+QK+
Sbjct: 129 WWSYEFCHQKY 139


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,417,851
Number of Sequences: 28952
Number of extensions: 283130
Number of successful extensions: 463
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 457
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 463
length of database: 12,070,560
effective HSP length: 79
effective length of database: 9,783,352
effective search space used: 1614253080
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)