BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0610 (547 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_01_0570 + 4026889-4027537,4028340-4028689,4029258-4029433,402... 27 7.4 >06_01_0570 + 4026889-4027537,4028340-4028689,4029258-4029433, 4029593-4029659,4029746-4029780,4030084-4030186, 4031606-4031699,4031764-4031813,4031889-4032000, 4032275-4032401,4032491-4032941 Length = 737 Score = 27.5 bits (58), Expect = 7.4 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +2 Query: 164 SLVFFNGESILEMIFHYWIIFLFLVFKSHCFDVGRTSC 277 SLV F +L ++ + FLFLV+ CFD+ + C Sbjct: 448 SLVHFATTRMLNLV----LPFLFLVYDLDCFDLSKLEC 481 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,773,620 Number of Sequences: 37544 Number of extensions: 304852 Number of successful extensions: 504 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 499 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 504 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1222086348 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -