BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0610 (547 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamat... 23 2.7 AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 23 2.7 AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamat... 23 2.7 DQ026039-1|AAY87898.1| 427|Apis mellifera nicotinic acetylcholi... 22 4.7 AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor p... 21 8.2 >AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamate receptor 1 protein. Length = 843 Score = 22.6 bits (46), Expect = 2.7 Identities = 9/27 (33%), Positives = 16/27 (59%) Frame = +3 Query: 354 RCNYTETFEFLSKGGWHIYVVDVYGLQ 434 R N ++ F++L+ GW + V GL+ Sbjct: 218 RSNLSQPFQWLASDGWGRQIKLVEGLE 244 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 22.6 bits (46), Expect = 2.7 Identities = 7/16 (43%), Positives = 9/16 (56%) Frame = +3 Query: 354 RCNYTETFEFLSKGGW 401 RCN T F ++ GW Sbjct: 363 RCNATGAFSWIGSDGW 378 >AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamate receptor protein. Length = 933 Score = 22.6 bits (46), Expect = 2.7 Identities = 9/27 (33%), Positives = 16/27 (59%) Frame = +3 Query: 354 RCNYTETFEFLSKGGWHIYVVDVYGLQ 434 R N ++ F++L+ GW + V GL+ Sbjct: 308 RSNLSQPFQWLASDGWGRQIKLVEGLE 334 >DQ026039-1|AAY87898.1| 427|Apis mellifera nicotinic acetylcholine receptor beta2subunit protein. Length = 427 Score = 21.8 bits (44), Expect = 4.7 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = -2 Query: 147 EGSSRGIMII*KLNFVLKLLAL 82 E SS MII LNF+L L L Sbjct: 268 EPSSTERMIIANLNFILHLFCL 289 >AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor protein. Length = 587 Score = 21.0 bits (42), Expect = 8.2 Identities = 9/34 (26%), Positives = 19/34 (55%) Frame = +2 Query: 191 ILEMIFHYWIIFLFLVFKSHCFDVGRTSCESARV 292 +L M+F YW I+ V + + G + +S+++ Sbjct: 260 MLVMLFFYWRIYNAAVSTTKAINQGFRTTKSSKM 293 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 155,503 Number of Sequences: 438 Number of extensions: 3275 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 15581757 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -