BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0608 (696 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_45245| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_57159| Best HMM Match : PI-PLC-X (HMM E-Value=0) 29 3.6 >SB_45245| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 258 Score = 30.3 bits (65), Expect = 1.6 Identities = 19/72 (26%), Positives = 36/72 (50%) Frame = -1 Query: 501 RTLAILVPLFLSGGTGVRHNPVRYRTGYP*MDSQELKKGSTFFTSLKTGTNQTTKELTDG 322 RTL ++ + ++GG V+ PVR +D E ++ T + +T T+ + Sbjct: 60 RTLPLIEDVSVNGGAAVKKKPVRLTKSLNFLDENEARRSHT--SRRRTYTSGAISKDVTF 117 Query: 321 SRNSSSYALLST 286 S+N ++ AL S+ Sbjct: 118 SKNLTTRALASS 129 >SB_57159| Best HMM Match : PI-PLC-X (HMM E-Value=0) Length = 1289 Score = 29.1 bits (62), Expect = 3.6 Identities = 14/43 (32%), Positives = 20/43 (46%) Frame = -3 Query: 322 KQKFQQLRSTLNTSTMLSSGLRIDRAGAGESYYRRPRSSALRI 194 K+ + N ST S L + +GAG YY R R S + + Sbjct: 973 KKSYSASSIASNPSTQSLSSLNSNSSGAGSQYYTRSRESVVTL 1015 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,499,186 Number of Sequences: 59808 Number of extensions: 339039 Number of successful extensions: 649 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 615 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 649 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1817559367 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -