BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0607 (651 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g41440.1 68415.m05120 expressed protein 29 2.7 At1g08620.1 68414.m00955 transcription factor jumonji (jmj) fami... 29 3.5 At4g37770.1 68417.m05346 1-aminocyclopropane-1-carboxylate synth... 28 6.2 At5g55180.1 68418.m06879 glycosyl hydrolase family 17 protein si... 27 8.2 At5g35380.1 68418.m04205 protein kinase family protein contains ... 27 8.2 >At2g41440.1 68415.m05120 expressed protein Length = 544 Score = 29.1 bits (62), Expect = 2.7 Identities = 19/73 (26%), Positives = 37/73 (50%) Frame = +3 Query: 111 YDKINLQEILENKRLLESYVDCVLGKGKCTPEGKELKDHLQEALETGCEKCTEAQEKGAE 290 ++ ++++ L+ RLL + C G PE LK HLQ AL ++ + ++ E Sbjct: 392 HEAVSMENELKRLRLLTRRMTCKDLDGLTFPELLSLKSHLQTALLIVKDQTKKIEQLLKE 451 Query: 291 TSIDYLIKNELEI 329 LI+++L++ Sbjct: 452 DDGWMLIRSQLQL 464 >At1g08620.1 68414.m00955 transcription factor jumonji (jmj) family protein / zinc finger (C5HC2 type) family protein contains Pfam domains, PF02375: jmjN domain, PF02373: jmjC domain and PF02928: C5HC2 zinc finger Length = 1183 Score = 28.7 bits (61), Expect = 3.5 Identities = 15/54 (27%), Positives = 26/54 (48%) Frame = +3 Query: 213 ELKDHLQEALETGCEKCTEAQEKGAETSIDYLIKNELEIWKELTAHFDPDGKWR 374 ++K L + + GCE+C + Q K E +++Y+ K E K P W+ Sbjct: 107 DVKPALPKGVVRGCEECKDCQ-KEFEDTLNYIAKIRPEAEKYGICRIVPPPSWK 159 >At4g37770.1 68417.m05346 1-aminocyclopropane-1-carboxylate synthase, putative / ACC synthase, putative similar to 1-aminocyclopropane-1-carboxylate synthase, Arabidopsis thaliana, GI:940370 [S71174] Length = 469 Score = 27.9 bits (59), Expect = 6.2 Identities = 15/42 (35%), Positives = 21/42 (50%) Frame = +1 Query: 316 MNWKFGRS*QPISTPTANGGRSTKTALRPRASSSLNKTSIKL 441 + W+ G PI +ANG R TK AL A K ++K+ Sbjct: 152 LKWRTGAEIVPIQCKSANGFRITKVALE-EAYEQAQKLNLKV 192 >At5g55180.1 68418.m06879 glycosyl hydrolase family 17 protein similar to elicitor inducible chitinase Nt-SubE76 GI:11071974 from [Nicotiana tabacum] Length = 460 Score = 27.5 bits (58), Expect = 8.2 Identities = 12/38 (31%), Positives = 19/38 (50%) Frame = +3 Query: 141 ENKRLLESYVDCVLGKGKCTPEGKELKDHLQEALETGC 254 +NK + ++G+ C GK K+ LQE L+ C Sbjct: 355 DNKEKVVPVKPSLVGQTWCVANGKTTKEKLQEGLDYAC 392 >At5g35380.1 68418.m04205 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 731 Score = 27.5 bits (58), Expect = 8.2 Identities = 12/39 (30%), Positives = 24/39 (61%) Frame = +3 Query: 201 PEGKELKDHLQEALETGCEKCTEAQEKGAETSIDYLIKN 317 PE K+L+D +E+++ G + + + G+ TSI +I + Sbjct: 675 PELKKLRDLAEESIKFGVRQPSPIRSSGSATSIQEIISD 713 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,262,015 Number of Sequences: 28952 Number of extensions: 219702 Number of successful extensions: 617 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 609 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 617 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1354097952 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -