BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0605 (320 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_4413| Best HMM Match : No HMM Matches (HMM E-Value=.) 124 2e-29 SB_36994| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 7.9 >SB_4413| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 252 Score = 124 bits (299), Expect = 2e-29 Identities = 54/74 (72%), Positives = 61/74 (82%) Frame = -3 Query: 318 IPAPRGTGIVFAPVPKKLFQMAGVQDCYTSARGSTGPLGNFAKATYAAIPHTYAYLTPKL 139 IPAPRGTGIV APVPKKL QMAG++DCYTS RG T LGNFAKAT+AAI TYAYLTP + Sbjct: 144 IPAPRGTGIVSAPVPKKLLQMAGIEDCYTSTRGQTATLGNFAKATFAAISETYAYLTPDM 203 Query: 138 WRDIPLTKSPYSEF 97 W++ TK+PY EF Sbjct: 204 WKETVFTKTPYQEF 217 >SB_36994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 618 Score = 25.8 bits (54), Expect = 7.9 Identities = 14/38 (36%), Positives = 22/38 (57%) Frame = +1 Query: 148 SEVGICVGNGSICGFSKISQGAS*TTS*GVAVLYTSHL 261 S++G C+G + GF + GAS T + GV + +S L Sbjct: 50 SDMGCCIGAPFLNGFCIRNTGASATAALGVNGIVSSFL 87 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,755,643 Number of Sequences: 59808 Number of extensions: 188163 Number of successful extensions: 422 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 395 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 422 length of database: 16,821,457 effective HSP length: 72 effective length of database: 12,515,281 effective search space used: 425519554 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -