BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0602 (645 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory recept... 23 2.2 AM292381-1|CAL23193.2| 364|Tribolium castaneum gustatory recept... 23 2.2 EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggeri... 23 2.8 EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggeri... 23 2.8 AM292364-1|CAL23176.2| 353|Tribolium castaneum gustatory recept... 21 8.7 >AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory receptor candidate 61 protein. Length = 670 Score = 23.0 bits (47), Expect = 2.2 Identities = 9/24 (37%), Positives = 12/24 (50%) Frame = -3 Query: 382 HPTYINNLDLKNIAKLREYHNNIM 311 HPTY K + K +Y N I+ Sbjct: 303 HPTYFGKTGRKTVLKTNKYCNFII 326 >AM292381-1|CAL23193.2| 364|Tribolium castaneum gustatory receptor candidate 60 protein. Length = 364 Score = 23.0 bits (47), Expect = 2.2 Identities = 8/22 (36%), Positives = 12/22 (54%) Frame = +2 Query: 254 LQKQCSTEILHIYFLCLICHNI 319 L K C I +Y+L +C N+ Sbjct: 254 LIKNCVIVIFELYYLSHVCQNV 275 >EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggering hormone receptorisoform B protein. Length = 451 Score = 22.6 bits (46), Expect = 2.8 Identities = 10/33 (30%), Positives = 16/33 (48%) Frame = -3 Query: 457 NHSPSAWLYGRLLTKAVKRSLRSILHPTYINNL 359 N P W+ GR + KAV ++ H + + L Sbjct: 130 NSRPETWVLGREMCKAVPFVELTVAHASVLTIL 162 >EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggering hormone receptorisoform A protein. Length = 434 Score = 22.6 bits (46), Expect = 2.8 Identities = 10/33 (30%), Positives = 16/33 (48%) Frame = -3 Query: 457 NHSPSAWLYGRLLTKAVKRSLRSILHPTYINNL 359 N P W+ GR + KAV ++ H + + L Sbjct: 130 NSRPETWVLGREMCKAVPFVELTVAHASVLTIL 162 >AM292364-1|CAL23176.2| 353|Tribolium castaneum gustatory receptor candidate 43 protein. Length = 353 Score = 21.0 bits (42), Expect = 8.7 Identities = 11/36 (30%), Positives = 16/36 (44%) Frame = -2 Query: 350 KYRKTTRIS**YYDRLSTRNIYGVFLYYIVFGERKK 243 K +KT R YY YGV + Y + + +K Sbjct: 106 KIKKTKRYCYYYYAFFGVHLAYGVVIIYSICVQTEK 141 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 149,382 Number of Sequences: 336 Number of extensions: 3076 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16552695 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -