SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ceN-0602
         (645 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AE014296-64|AAF47364.2| 1773|Drosophila melanogaster CG7020-PA p...    29   5.4  

>AE014296-64|AAF47364.2| 1773|Drosophila melanogaster CG7020-PA
            protein.
          Length = 1773

 Score = 29.1 bits (62), Expect = 5.4
 Identities = 18/53 (33%), Positives = 25/53 (47%), Gaps = 3/53 (5%)
 Frame = -3

Query: 457  NHSPSAWLYGRLLTKAVKRSLRSILHPTYI---NNLDLKNIAKLREYHNNIMT 308
            NH P   L G  L +A +R L   LHP  +    +  + N+ K RE H  + T
Sbjct: 1032 NHLPKTPLGGIHLCEARRRFLEGSLHPANVLMCPHTCVTNLPKPRELHQGVQT 1084


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 26,012,224
Number of Sequences: 53049
Number of extensions: 496840
Number of successful extensions: 849
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 837
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 849
length of database: 24,988,368
effective HSP length: 82
effective length of database: 20,638,350
effective search space used: 2724262200
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -