BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0602 (645 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g28590.1 68415.m03474 protein kinase family protein contains ... 29 2.6 At4g14590.1 68417.m02245 expressed protein 27 8.1 >At2g28590.1 68415.m03474 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 424 Score = 29.1 bits (62), Expect = 2.6 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = -2 Query: 287 YGVFLYYIVFGERKKQSTHTNNCQSLLRLMNSKFKSK 177 +GV L ++ G + +T T N QSL+ N FK + Sbjct: 288 FGVVLLELITGRKAYDNTRTRNHQSLVEWANPLFKDR 324 >At4g14590.1 68417.m02245 expressed protein Length = 508 Score = 27.5 bits (58), Expect = 8.1 Identities = 13/45 (28%), Positives = 25/45 (55%) Frame = -3 Query: 358 DLKNIAKLREYHNNIMTD*AQEIYMEYFCTTLFLEREKNNLHTQI 224 DL ++++ RE N+++++ EIY + FL R + TQ+ Sbjct: 214 DLSHVSEFREIWNDLVSNHCSEIYQLKTSSRYFLLRITPEMETQL 258 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,592,482 Number of Sequences: 28952 Number of extensions: 236053 Number of successful extensions: 455 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 453 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 455 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1334473344 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -