BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0597 (546 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_06_0510 + 24420402-24422582 31 0.60 07_01_0733 + 5570084-5570282,5570395-5570600,5572484-5572624,557... 30 1.4 02_03_0144 + 15694766-15694883,15694980-15697612 29 3.2 01_06_0542 + 30096277-30096340,30096444-30096529,30096810-300969... 29 3.2 05_03_0579 - 15714195-15714887 27 7.4 02_05_0817 + 31994241-31995908 27 7.4 12_01_0107 - 843820-846335,846400-846511 27 9.8 05_07_0361 + 29555446-29556138 27 9.8 04_04_0036 - 22307328-22308026 27 9.8 03_05_1160 + 30826972-30828375,30828641-30828754,30828901-308290... 27 9.8 >11_06_0510 + 24420402-24422582 Length = 726 Score = 31.1 bits (67), Expect = 0.60 Identities = 17/43 (39%), Positives = 23/43 (53%), Gaps = 1/43 (2%) Frame = -2 Query: 155 D*CFLCSRPSDRSGPGCVSTDRNVRSKC-RCSNVSCSSHYDAQ 30 D CF + P+D+ GC S + SKC RC S S + DA+ Sbjct: 504 DLCFYANHPADKDDDGCCSCSSS--SKCLRCLCSSSSGYPDAE 544 >07_01_0733 + 5570084-5570282,5570395-5570600,5572484-5572624, 5572773-5572949,5573049-5573145,5573575-5573687, 5573774-5573896,5574004-5574075,5575340-5575432, 5575564-5575674,5575767-5575889,5576834-5576890, 5576939-5577022,5577140-5577214,5577418-5577554, 5577719-5577853,5579029-5579168,5579334-5579399, 5579732-5579838,5579910-5579990,5580064-5580138, 5580224-5580325,5581837-5582005,5582090-5582217, 5582596-5582679,5582779-5582879,5583729-5583882, 5583964-5584038,5584112-5584262,5584463-5585078, 5585427-5585487,5585874-5586019,5586104-5586287, 5586363-5586440,5586603-5586931,5587023-5587199, 5587571-5587667,5587742-5587897,5587962-5588198, 5588271-5588354,5588426-5588486,5588762-5588898 Length = 1912 Score = 29.9 bits (64), Expect = 1.4 Identities = 20/72 (27%), Positives = 36/72 (50%), Gaps = 2/72 (2%) Frame = +2 Query: 26 LTARHS-VNCRTHLNIDISNAHCGPWRHIQDHSCLRAGC-IKNINHIAWVVPRS*SVALT 199 L+A+ S +NC + + +IS H G H + + AGC ++ + H+ P+ A+ Sbjct: 725 LSAKQSLINCASDIPSEISQMHAGSVFHGYVCNIIEAGCFVRFLGHLTGFSPK--DKAVD 782 Query: 200 RSALRVRTRRYV 235 RS ++ YV Sbjct: 783 RSVEKLSNAFYV 794 >02_03_0144 + 15694766-15694883,15694980-15697612 Length = 916 Score = 28.7 bits (61), Expect = 3.2 Identities = 15/35 (42%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Frame = -2 Query: 224 EYERVTRNASTRRITSAAPPTQCD*CF-LCSRPSD 123 E +RV R R ++ A+P T C+ CF L PSD Sbjct: 732 EQKRVVRKHILRPVSGASPFTVCNSCFNLVQMPSD 766 >01_06_0542 + 30096277-30096340,30096444-30096529,30096810-30096934, 30097405-30097513,30097865-30097981,30098066-30098149, 30098795-30098914,30099416-30099502,30100160-30100237 Length = 289 Score = 28.7 bits (61), Expect = 3.2 Identities = 17/37 (45%), Positives = 20/37 (54%) Frame = +2 Query: 104 HIQDHSCLRAGCIKNINHIAWVVPRS*SVALTRSALR 214 HI S L G + N+N IA VPR VA R+ LR Sbjct: 183 HIGSFSFLGGGSVFNLNQIAQDVPRYMMVAGDRAELR 219 >05_03_0579 - 15714195-15714887 Length = 230 Score = 27.5 bits (58), Expect = 7.4 Identities = 17/43 (39%), Positives = 22/43 (51%) Frame = -3 Query: 196 QRDGSRARHHPRNVINVFYAAGPQTGVVLDVSPRTAMCVRNVD 68 QR G+ R HPR V++ A G T V +PR A R +D Sbjct: 148 QRGGTLPRQHPRQVLS---ATGRPTVVSSSNAPRIAPIWRPID 187 >02_05_0817 + 31994241-31995908 Length = 555 Score = 27.5 bits (58), Expect = 7.4 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +3 Query: 165 GWCRARDPSR 194 GWCRARDP R Sbjct: 264 GWCRARDPKR 273 >12_01_0107 - 843820-846335,846400-846511 Length = 875 Score = 27.1 bits (57), Expect = 9.8 Identities = 14/35 (40%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Frame = -2 Query: 224 EYERVTRNASTRRITSAAPPTQCD*CF-LCSRPSD 123 E +R R + R ++ A+P T C+ CF L PSD Sbjct: 693 EQKRAVRKSILRSLSGASPFTICNGCFNLVQVPSD 727 >05_07_0361 + 29555446-29556138 Length = 230 Score = 27.1 bits (57), Expect = 9.8 Identities = 17/43 (39%), Positives = 22/43 (51%) Frame = -3 Query: 196 QRDGSRARHHPRNVINVFYAAGPQTGVVLDVSPRTAMCVRNVD 68 QR G+ R HPR V++ A G T V +PR A R +D Sbjct: 148 QRGGTPLRQHPRQVLS---APGRPTVVSSSNAPRIAPIWRPID 187 >04_04_0036 - 22307328-22308026 Length = 232 Score = 27.1 bits (57), Expect = 9.8 Identities = 13/35 (37%), Positives = 17/35 (48%), Gaps = 2/35 (5%) Frame = -2 Query: 134 RPSDRSGPGCVSTDRNVR--SKCRCSNVSCSSHYD 36 RP R G + +R V+ CRC+ C HYD Sbjct: 113 RPLPRHGTTETAAERQVQRGGPCRCACNYCGGHYD 147 >03_05_1160 + 30826972-30828375,30828641-30828754,30828901-30829032, 30830087-30830224 Length = 595 Score = 27.1 bits (57), Expect = 9.8 Identities = 15/43 (34%), Positives = 22/43 (51%), Gaps = 2/43 (4%) Frame = -2 Query: 143 LCSRPSDRSGPGCVSTDRNVRSKCRCSNVS--CSSHYDAQLTA 21 +C P + S G ++ D + S+C CS S S+H DA A Sbjct: 347 MCPEPDNGSLDGRLTEDPPLSSRCDCSKQSEKKSAHLDANCCA 389 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,133,152 Number of Sequences: 37544 Number of extensions: 239013 Number of successful extensions: 603 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 601 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 603 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1222086348 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -