BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0597 (546 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g26190.1 68418.m03116 DC1 domain-containing protein contains ... 28 3.5 At1g23140.1 68414.m02892 C2 domain-containing protein similar to... 28 4.7 >At5g26190.1 68418.m03116 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 556 Score = 28.3 bits (60), Expect = 3.5 Identities = 15/46 (32%), Positives = 23/46 (50%) Frame = -2 Query: 149 CFLCSRPSDRSGPGCVSTDRNVRSKCRCSNVSCSSHYDAQLTAFFI 12 C C RPS+ G NV+ RC+ +S ++D+ L + FI Sbjct: 350 CVACQRPSN----GFRYESGNVKLDVRCATISDEFNHDSHLHSLFI 391 >At1g23140.1 68414.m02892 C2 domain-containing protein similar to zinc finger and C2 domain protein GI:9957238 from [Arabidopsis thaliana] Length = 165 Score = 27.9 bits (59), Expect = 4.7 Identities = 17/46 (36%), Positives = 23/46 (50%) Frame = -2 Query: 143 LCSRPSDRSGPGCVSTDRNVRSKCRCSNVSCSSHYDAQLTAFFIDP 6 L SR S+ S P V T + + K R SC+ +D +LT DP Sbjct: 18 LVSRDSNTSDPFVVVTMGSQKLKTRGVENSCNPEWDDELTLGINDP 63 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,320,052 Number of Sequences: 28952 Number of extensions: 185867 Number of successful extensions: 463 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 458 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 463 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1023490624 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -