BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0596 (737 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF592538-1|ABQ95984.1| 582|Tribolium castaneum beta-N-acetylglu... 27 0.16 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 23 1.9 AY008296-1|AAG22858.1| 556|Tribolium castaneum Dorsal protein. 22 5.9 >EF592538-1|ABQ95984.1| 582|Tribolium castaneum beta-N-acetylglucosaminidase NAG3 protein. Length = 582 Score = 27.1 bits (57), Expect = 0.16 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = -1 Query: 200 GGVCAPTTEWHARSDVRRATPFEEH 126 GGVC P T WH D R P+ +H Sbjct: 478 GGVCDPYTPWHTFYDYR---PWVQH 499 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 23.4 bits (48), Expect = 1.9 Identities = 10/36 (27%), Positives = 17/36 (47%) Frame = -3 Query: 693 YHSVYWVGVCNFQRLR*EGSHVVPPSQNGAAMPTVD 586 YH WVG + + +R + ++ GA T+D Sbjct: 933 YHGDQWVGFEDIKSVRDKAEYIKTKGFGGAVAWTID 968 >AY008296-1|AAG22858.1| 556|Tribolium castaneum Dorsal protein. Length = 556 Score = 21.8 bits (44), Expect = 5.9 Identities = 12/35 (34%), Positives = 17/35 (48%) Frame = +1 Query: 613 LRRRHDMRTLSS*PLEITYPDPVDRMVNRRRRPKH 717 LRR D T + P E+ D M+ R+R+ H Sbjct: 325 LRRPSDGATSEALPFELLPLDSEPGMLKRKRQKYH 359 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 178,584 Number of Sequences: 336 Number of extensions: 4035 Number of successful extensions: 6 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19779950 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -