BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0594 (688 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1F3.04c |||DUF367 family protein|Schizosaccharomyces pombe|c... 29 0.48 SPBP8B7.09c |||karyopherin|Schizosaccharomyces pombe|chr 2|||Manual 26 5.9 >SPAC1F3.04c |||DUF367 family protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 288 Score = 29.5 bits (63), Expect = 0.48 Identities = 17/60 (28%), Positives = 35/60 (58%), Gaps = 9/60 (15%) Frame = +1 Query: 439 YFVGFQN-SEVMINRDNWGHSYCDVRGEILG------SSQD--EHQRKHLPKVFSSIKNE 591 Y VG+ N + ++++ WGHS+ +V E+L +QD E ++K+L ++ +S + + Sbjct: 142 YIVGYPNEARLLMDNFKWGHSFFEVNEELLDIYAQCHDAQDIQEKEKKYLEEMEASYQEQ 201 >SPBP8B7.09c |||karyopherin|Schizosaccharomyces pombe|chr 2|||Manual Length = 978 Score = 25.8 bits (54), Expect = 5.9 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = +1 Query: 484 NWGHSYCDVRGEILGSSQDEHQRKHLPKVFSSIKNE 591 NW + ++G I SSQ E +L KV SI +E Sbjct: 123 NWNDFFASLQGVIAASSQSEFSNFYL-KVLLSIGDE 157 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,629,732 Number of Sequences: 5004 Number of extensions: 50165 Number of successful extensions: 113 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 108 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 113 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 317927284 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -