BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0593 (361 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g12450.1 68417.m01970 expressed protein 33 0.057 At5g45350.1 68418.m05567 proline-rich family protein contains pr... 31 0.23 At1g27060.1 68414.m03299 regulator of chromosome condensation (R... 29 0.93 At1g68725.1 68414.m07853 arabinogalactan-protein, putative (AGP1... 28 1.6 At5g53440.1 68418.m06641 expressed protein 28 2.1 At4g31580.1 68417.m04485 splicing factor RSZp22 (RSZP22) / 9G8-l... 27 2.8 At3g61940.1 68416.m06956 zinc transporter, putative similar to z... 27 3.8 At2g07630.1 68415.m00881 hypothetical protein 27 3.8 At2g12100.1 68415.m01300 Ulp1 protease family protein contains P... 27 5.0 At2g03150.1 68415.m00268 ATP/GTP-binding protein family contains... 27 5.0 At1g45090.1 68414.m05169 Ulp1 protease family protein similar to... 27 5.0 At5g64200.2 68418.m08063 arginine/serine-rich splicing factor SC... 26 6.6 At5g64200.1 68418.m08062 arginine/serine-rich splicing factor SC... 26 6.6 At4g09060.1 68417.m01493 expressed protein 26 6.6 At5g35750.1 68418.m04281 histidine kinase (AHK2) identical to hi... 26 8.7 At4g18160.1 68417.m02698 outward rectifying potassium channel, p... 26 8.7 At4g11610.1 68417.m01859 C2 domain-containing protein contains I... 26 8.7 At2g46610.2 68415.m05813 arginine/serine-rich splicing factor, p... 26 8.7 At2g46610.1 68415.m05814 arginine/serine-rich splicing factor, p... 26 8.7 At1g21580.1 68414.m02698 hydroxyproline-rich glycoprotein family... 26 8.7 >At4g12450.1 68417.m01970 expressed protein Length = 277 Score = 33.1 bits (72), Expect = 0.057 Identities = 19/61 (31%), Positives = 29/61 (47%) Frame = -3 Query: 347 PSGRCRAVSRDIRTTTEARRPGTARNTRRPKPTELSVCCRERSETPRHRNKPSRPVWSRR 168 PS CR RD+ T +PGT + +P P+ +C R E + + P+R S R Sbjct: 32 PSYSCRKNVRDVVNT----QPGTVKKNPKPDPSLRRLCSSRRPELDSNSHHPTRRSVSAR 87 Query: 167 S 165 + Sbjct: 88 A 88 >At5g45350.1 68418.m05567 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 177 Score = 31.1 bits (67), Expect = 0.23 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 288 APGLCGGPDVPAHGSAPPGGVP 353 APG G P P HG PP G P Sbjct: 73 APGYGGYPPAPGHGGYPPAGYP 94 >At1g27060.1 68414.m03299 regulator of chromosome condensation (RCC1) family protein low similiarity to UVB-resistance protein UVR8 [Arabidopsis thaliana] GI:5478530; contains Pfam profile PF00415: Regulator of chromosome condensation (RCC1) Length = 386 Score = 29.1 bits (62), Expect = 0.93 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = +3 Query: 282 AWAPGLCGGPDVPAHGSAP 338 +W G CGGPDV A S P Sbjct: 229 SWGRGFCGGPDVHAPQSLP 247 >At1g68725.1 68414.m07853 arabinogalactan-protein, putative (AGP19) non-consensus splice site at the intron:exon boundary (AT:exon) Length = 247 Score = 28.3 bits (60), Expect = 1.6 Identities = 11/25 (44%), Positives = 13/25 (52%) Frame = -2 Query: 360 PAGAPLRAVQSREQGHQDHHRGPAP 286 PA AP R+ H+ HH PAP Sbjct: 166 PAPAPAPTKHKRKHKHKRHHHAPAP 190 >At5g53440.1 68418.m06641 expressed protein Length = 1181 Score = 27.9 bits (59), Expect = 2.1 Identities = 11/38 (28%), Positives = 20/38 (52%) Frame = -2 Query: 354 GAPLRAVQSREQGHQDHHRGPAPRHSEKHSASEADRAE 241 G R+++ E GH+++ R + E+H E +AE Sbjct: 546 GGARRSIEVEETGHRNNARDYSATEEERHLVDETSQAE 583 >At4g31580.1 68417.m04485 splicing factor RSZp22 (RSZP22) / 9G8-like SR protein (SRZ22) identical to RSZp22 protein [Arabidopsis thaliana] gi|2582645|emb|CAA05352, 9G8-like SR protein [Arabidopsis thaliana] GI:3435094; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) and PF00098: Zinc knuckle; identical to cDNA 9G8-like SR protein (SRZ22) GI:3435093 Length = 200 Score = 27.5 bits (58), Expect = 2.8 Identities = 20/63 (31%), Positives = 24/63 (38%) Frame = -3 Query: 353 GHPSGRCRAVSRDIRTTTEARRPGTARNTRRPKPTELSVCCRERSETPRHRNKPSRPVWS 174 GH + CR R +++R R R P S R RS P R PS P Sbjct: 108 GHFARECRNRGGTGRRRSKSRSRTPPRYRRSPSYGRRSYSPRARSPPPPRRRSPSPPPAR 167 Query: 173 RRS 165 RS Sbjct: 168 GRS 170 >At3g61940.1 68416.m06956 zinc transporter, putative similar to zinc transporter ZAT [Arabidopsis thaliana] gi|4206640|gb|AAD11757; similar to zinc transporter ZnT-2 [Rattus norvegicus] gi|1256378|gb|AAB02775; member of the cation diffusion facilitator (CDF) family, or cation efflux (CE) family, PMID:11500563 Length = 334 Score = 27.1 bits (57), Expect = 3.8 Identities = 14/29 (48%), Positives = 16/29 (55%) Frame = -2 Query: 318 GHQDHHRGPAPRHSEKHSASEADRAERLL 232 GH DH G HS H S +RAE+LL Sbjct: 157 GH-DHGHGHDHGHSHDHGHSYGERAEQLL 184 >At2g07630.1 68415.m00881 hypothetical protein Length = 458 Score = 27.1 bits (57), Expect = 3.8 Identities = 19/57 (33%), Positives = 30/57 (52%), Gaps = 1/57 (1%) Frame = +2 Query: 110 QQLNCSSSISKYYNGNGVDSVETKQVEKVYSGDGASLSAPGSKRSA-LSASDAECFS 277 Q L C + +K Y + DS++ + YS + + + P SKRS+ S S A+ FS Sbjct: 369 QYLVCVENENKRYQMH--DSIDQCSLMLTYSEEPSEATTPSSKRSSDTSISPADNFS 423 >At2g12100.1 68415.m01300 Ulp1 protease family protein contains Pfam profile PF02902: Ulp1 protease family, C-terminal catalytic domain; similar to At5g28270, At2g05450, At1g45090, At2g16180, At2g06750 Length = 1224 Score = 26.6 bits (56), Expect = 5.0 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = -2 Query: 300 RGPAPRHSEKHSASEADRAERLLPGALRDAPSPE 199 R P+P H +H + E+LLP + P+ E Sbjct: 681 RVPSPSHQPEHGIPDGGNFEQLLPDPILSDPALE 714 >At2g03150.1 68415.m00268 ATP/GTP-binding protein family contains ATP/GTP-binding site motif A (P-loop), PROSITE:PS00017 Length = 1340 Score = 26.6 bits (56), Expect = 5.0 Identities = 15/53 (28%), Positives = 23/53 (43%) Frame = -3 Query: 299 EARRPGTARNTRRPKPTELSVCCRERSETPRHRNKPSRPVWSRRSPHHFHCSI 141 E +R + R P S +ER+ P+ ++ +R RR HH SI Sbjct: 418 ERKRALEIKRDRTPTARATSKDTKERTPVPKSISRDARSSSLRRDAHHREASI 470 >At1g45090.1 68414.m05169 Ulp1 protease family protein similar to At5g28270, At2g12100, At2g05450, At2g16180, At2g06750; contains Pfam profile PF02902: Ulp1 protease family, C-terminal catalytic domain Length = 1210 Score = 26.6 bits (56), Expect = 5.0 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = -2 Query: 300 RGPAPRHSEKHSASEADRAERLLPGALRDAPSPE 199 R P+P H +H + E+LLP + P+ E Sbjct: 672 RVPSPSHQPEHGIPDGGNFEQLLPDPILSDPALE 705 >At5g64200.2 68418.m08063 arginine/serine-rich splicing factor SC35 contains similarity to splicing factor; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 303 Score = 26.2 bits (55), Expect = 6.6 Identities = 18/66 (27%), Positives = 27/66 (40%), Gaps = 2/66 (3%) Frame = -3 Query: 353 GHPSGRCRAVSRDIRTTTEARRPGTARNTRRPKPTELSVCCR--ERSETPRHRNKPSRPV 180 G R+ SR + + R P ++ + E+S R ERS +PR P P Sbjct: 199 GRYDNESRSHSRSLSASPARRSPRSSSPQKTSPAREVSPDKRSNERSPSPRRSLSPRSPA 258 Query: 179 WSRRSP 162 + SP Sbjct: 259 LQKASP 264 >At5g64200.1 68418.m08062 arginine/serine-rich splicing factor SC35 contains similarity to splicing factor; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 303 Score = 26.2 bits (55), Expect = 6.6 Identities = 18/66 (27%), Positives = 27/66 (40%), Gaps = 2/66 (3%) Frame = -3 Query: 353 GHPSGRCRAVSRDIRTTTEARRPGTARNTRRPKPTELSVCCR--ERSETPRHRNKPSRPV 180 G R+ SR + + R P ++ + E+S R ERS +PR P P Sbjct: 199 GRYDNESRSHSRSLSASPARRSPRSSSPQKTSPAREVSPDKRSNERSPSPRRSLSPRSPA 258 Query: 179 WSRRSP 162 + SP Sbjct: 259 LQKASP 264 >At4g09060.1 68417.m01493 expressed protein Length = 341 Score = 26.2 bits (55), Expect = 6.6 Identities = 13/42 (30%), Positives = 21/42 (50%), Gaps = 2/42 (4%) Frame = -3 Query: 293 RRPGTARNTRRPKPTELSVCCRERSE--TPRHRNKPSRPVWS 174 R +A++ +R P +S +R E +P KP PVW+ Sbjct: 290 RNSASAKSNKRKSPKTMSSPVEKRLEFSSPEISRKPLSPVWN 331 >At5g35750.1 68418.m04281 histidine kinase (AHK2) identical to histidine kinase AHK2 [Arabidopsis thaliana] gi|13537196|dbj|BAB40774 Length = 1176 Score = 25.8 bits (54), Expect = 8.7 Identities = 11/39 (28%), Positives = 21/39 (53%) Frame = +2 Query: 116 LNCSSSISKYYNGNGVDSVETKQVEKVYSGDGASLSAPG 232 + SS S+ Y G G+ +K++ ++ G+ +S PG Sbjct: 816 MQADSSTSRTYGGTGIGLSISKRLVELMQGEMGFVSEPG 854 >At4g18160.1 68417.m02698 outward rectifying potassium channel, putative (KCO6) similar to kco1 [Arabidopsis thaliana] gi|2230761|emb|CAA69158; member of the 2 pore, 4 transmembrane (2P/4TM) K+ channel family, PMID:11500563 Length = 436 Score = 25.8 bits (54), Expect = 8.7 Identities = 12/30 (40%), Positives = 22/30 (73%), Gaps = 1/30 (3%) Frame = +1 Query: 238 TLSSVGFGRRVFLAVPGRR-ASVVVLMSLL 324 ++++VG+G R F +PGR A++ +L+S L Sbjct: 310 SVTTVGYGDRAFKTLPGRLFAAIWLLVSTL 339 >At4g11610.1 68417.m01859 C2 domain-containing protein contains INTERPRO:IPR000008 C2 domain Length = 1011 Score = 25.8 bits (54), Expect = 8.7 Identities = 9/36 (25%), Positives = 17/36 (47%) Frame = -2 Query: 339 AVQSREQGHQDHHRGPAPRHSEKHSASEADRAERLL 232 ++ + + H +HH P+H SE R +L+ Sbjct: 193 SLAAEQDNHNEHHHHYVPKHQVDEMRSEPARPSKLV 228 >At2g46610.2 68415.m05813 arginine/serine-rich splicing factor, putative similar to SP|P92964 Arginine/serine-rich splicing factor RSP31 {Arabidopsis thaliana} Length = 224 Score = 25.8 bits (54), Expect = 8.7 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -3 Query: 230 RERSETPRHRNKPSRPVWSRRSPHH 156 R RS +P +R +PS RRSP + Sbjct: 154 RRRSPSPVYRRRPSPDYTRRRSPEY 178 >At2g46610.1 68415.m05814 arginine/serine-rich splicing factor, putative similar to SP|P92964 Arginine/serine-rich splicing factor RSP31 {Arabidopsis thaliana} Length = 250 Score = 25.8 bits (54), Expect = 8.7 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -3 Query: 230 RERSETPRHRNKPSRPVWSRRSPHH 156 R RS +P +R +PS RRSP + Sbjct: 180 RRRSPSPVYRRRPSPDYTRRRSPEY 204 >At1g21580.1 68414.m02698 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 1696 Score = 25.8 bits (54), Expect = 8.7 Identities = 14/46 (30%), Positives = 17/46 (36%) Frame = -3 Query: 293 RRPGTARNTRRPKPTELSVCCRERSETPRHRNKPSRPVWSRRSPHH 156 RR + R P+ R ETPR WSR+ HH Sbjct: 300 RREASNELNRTPRKQVQKKSALLRLETPRSYKNSRENEWSRQHNHH 345 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,307,174 Number of Sequences: 28952 Number of extensions: 162846 Number of successful extensions: 622 Number of sequences better than 10.0: 20 Number of HSP's better than 10.0 without gapping: 612 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 622 length of database: 12,070,560 effective HSP length: 72 effective length of database: 9,986,016 effective search space used: 469342752 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -