BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0592 (730 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPMIT.02 |||mitochondrial DNA binding endonuclease|Schizosacchar... 27 2.1 SPAC3A12.03c |mug145||ubiquitin-protein ligase E3 |Schizosacchar... 25 8.4 SPBC26H8.03 |cho2||phosphatidylethanolamine N-methyltransferase ... 25 8.4 >SPMIT.02 |||mitochondrial DNA binding endonuclease|Schizosaccharomyces pombe|chr mitochondrial|||Manual Length = 384 Score = 27.5 bits (58), Expect = 2.1 Identities = 17/57 (29%), Positives = 29/57 (50%) Frame = -3 Query: 293 KMLCNSFTAAVPKCHTFFLFY*TCYSFTVEVNREQLLSTYFIGKIGTRLRDFNTDAS 123 K + +SF + + FFL Y T YSF V + + L + +F TR++ + +S Sbjct: 45 KSIRDSFLSQLENILCFFLVYRTTYSFGVCLMKRFLFNKFFNRHPFTRVKSCFSSSS 101 >SPAC3A12.03c |mug145||ubiquitin-protein ligase E3 |Schizosaccharomyces pombe|chr 1|||Manual Length = 309 Score = 25.4 bits (53), Expect = 8.4 Identities = 16/43 (37%), Positives = 21/43 (48%) Frame = -3 Query: 212 TVEVNREQLLSTYFIGKIGTRLRDFNTDASQDTNAPDVLSCRL 84 T +V R L ST F+ +NTDAS ++ D SC L Sbjct: 158 TYDVRRPNLGSTSFVEMSSALSNIYNTDASDGDSSDD--SCLL 198 >SPBC26H8.03 |cho2||phosphatidylethanolamine N-methyltransferase Cho2|Schizosaccharomyces pombe|chr 2|||Manual Length = 905 Score = 25.4 bits (53), Expect = 8.4 Identities = 11/32 (34%), Positives = 16/32 (50%), Gaps = 2/32 (6%) Frame = +3 Query: 444 SNAFRFEQWGSRYNYTETLELIS--QGGWRIY 533 S A+ + QW YN T + IS W++Y Sbjct: 447 SAAYAWSQWKGLYNLTLNMSYISFVMAAWKLY 478 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,920,675 Number of Sequences: 5004 Number of extensions: 57480 Number of successful extensions: 99 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 98 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 99 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 343230174 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -