BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0590 (703 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY155490-1|AAO12861.1| 342|Apis mellifera Ammar1 transposase pr... 23 2.1 DQ026039-1|AAY87898.1| 427|Apis mellifera nicotinic acetylcholi... 22 6.5 >AY155490-1|AAO12861.1| 342|Apis mellifera Ammar1 transposase protein. Length = 342 Score = 23.4 bits (48), Expect = 2.1 Identities = 14/41 (34%), Positives = 19/41 (46%) Frame = +1 Query: 13 LFLFHNKIKNIFNQLKYAQCLLQWLD*ILLNGLRTK*LNGC 135 L + H I+N QL Y Q L W+ L T+ +N C Sbjct: 93 LHVSHTCIENHLKQLGYVQKLDTWVPHELKEKHLTQRINSC 133 >DQ026039-1|AAY87898.1| 427|Apis mellifera nicotinic acetylcholine receptor beta2subunit protein. Length = 427 Score = 21.8 bits (44), Expect = 6.5 Identities = 11/32 (34%), Positives = 15/32 (46%), Gaps = 3/32 (9%) Frame = -1 Query: 199 VPFKPLARICG---TYWAPHASSPDIHSATWS 113 VPF +C T+W + IH A+WS Sbjct: 150 VPFTTYTPVCEYDHTWWPYDILNCTIHIASWS 181 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 183,515 Number of Sequences: 438 Number of extensions: 3504 Number of successful extensions: 5 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21561255 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -