BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0588 (508 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_56505| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.7 SB_39726| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.7 >SB_56505| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 959 Score = 27.5 bits (58), Expect = 6.7 Identities = 12/41 (29%), Positives = 18/41 (43%) Frame = -2 Query: 303 CKRPERSQKPKQMEADGTKSHEGPSGTRPSAMKYSTKKKNS 181 CK P + Q+ + +A G H + K T KKN+ Sbjct: 485 CKEPGKVQEGLKGQAPGNSHHRSEKHVEAQSPKQKTSKKNN 525 >SB_39726| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 520 Score = 27.5 bits (58), Expect = 6.7 Identities = 13/26 (50%), Positives = 17/26 (65%), Gaps = 5/26 (19%) Frame = +2 Query: 224 VPDG-PSW----LFVPSASICFGFWL 286 +PD PSW +FV S SIC+G W+ Sbjct: 215 IPDSDPSWGIDIVFVKSTSICYGPWV 240 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,402,168 Number of Sequences: 59808 Number of extensions: 342959 Number of successful extensions: 942 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 896 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 942 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1111677931 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -