BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0588 (508 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF515471-1|AAM61879.1| 225|Anopheles gambiae glutathione S-tran... 24 2.6 AF491816-1|AAM09542.2| 225|Anopheles gambiae glutathione S-tran... 24 2.6 EF519528-1|ABP73591.1| 250|Anopheles gambiae APL2 protein. 23 4.5 EF519526-1|ABP73589.1| 250|Anopheles gambiae APL2 protein. 23 4.5 EF519525-1|ABP73588.1| 250|Anopheles gambiae APL2 protein. 23 4.5 EF519524-1|ABP73587.1| 250|Anopheles gambiae APL2 protein. 23 4.5 EF519523-1|ABP73586.1| 250|Anopheles gambiae APL2 protein. 23 4.5 EF519522-1|ABP73585.1| 250|Anopheles gambiae APL2 protein. 23 4.5 EF519521-1|ABP73584.1| 250|Anopheles gambiae APL2 protein. 23 4.5 EF519520-1|ABP73583.1| 250|Anopheles gambiae APL2 protein. 23 4.5 EF519519-1|ABP73582.1| 250|Anopheles gambiae APL2 protein. 23 4.5 EF519517-1|ABP73580.1| 250|Anopheles gambiae APL2 protein. 23 4.5 EF519516-1|ABP73579.1| 250|Anopheles gambiae APL2 protein. 23 4.5 EF519515-1|ABP73578.1| 250|Anopheles gambiae APL2 protein. 23 4.5 EF519514-1|ABP73577.1| 250|Anopheles gambiae APL2 protein. 23 4.5 EF519513-1|ABP73576.1| 250|Anopheles gambiae APL2 protein. 23 4.5 EF519512-1|ABP73575.1| 250|Anopheles gambiae APL2 protein. 23 4.5 EF519511-1|ABP73574.1| 250|Anopheles gambiae APL2 protein. 23 4.5 EF519510-1|ABP73573.1| 250|Anopheles gambiae APL2 protein. 23 4.5 EF519509-1|ABP73572.1| 250|Anopheles gambiae APL2 protein. 23 4.5 EF519508-1|ABP73571.1| 250|Anopheles gambiae APL2 protein. 23 4.5 EF519507-1|ABP73570.1| 250|Anopheles gambiae APL2 protein. 23 4.5 AY118017-1|AAM66816.1| 120|Anopheles gambiae glucose-6-phosphat... 23 4.5 AY118012-1|AAM66811.1| 120|Anopheles gambiae glucose-6-phosphat... 23 4.5 AY118011-1|AAM66810.1| 120|Anopheles gambiae glucose-6-phosphat... 23 4.5 AY118010-1|AAM66809.1| 120|Anopheles gambiae glucose-6-phosphat... 23 4.5 AY118002-1|AAM66801.1| 120|Anopheles gambiae glucose-6-phosphat... 23 4.5 AY118001-1|AAM66800.1| 120|Anopheles gambiae glucose-6-phosphat... 23 4.5 AY118000-1|AAM66799.1| 120|Anopheles gambiae glucose-6-phosphat... 23 4.5 AY117999-1|AAM66798.1| 120|Anopheles gambiae glucose-6-phosphat... 23 4.5 AY117998-1|AAM66797.1| 120|Anopheles gambiae glucose-6-phosphat... 23 4.5 AY117997-1|AAM66796.1| 120|Anopheles gambiae glucose-6-phosphat... 23 4.5 AY117996-1|AAM66795.1| 120|Anopheles gambiae glucose-6-phosphat... 23 4.5 AY117995-1|AAM66794.1| 120|Anopheles gambiae glucose-6-phosphat... 23 4.5 AY117994-1|AAM66793.1| 120|Anopheles gambiae glucose-6-phosphat... 23 4.5 AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein p... 23 4.5 AF317817-1|AAL18436.1| 137|Anopheles gambiae glucose-6-phosphat... 23 4.5 >AF515471-1|AAM61879.1| 225|Anopheles gambiae glutathione S-transferase 3-8 protein. Length = 225 Score = 24.2 bits (50), Expect = 2.6 Identities = 15/38 (39%), Positives = 18/38 (47%) Frame = +1 Query: 7 VHTDAHLPAGQIW*RRSQVITEAIRTAKDRKSWGGIEH 120 VHT HL AG I+ R S + I + K IEH Sbjct: 98 VHTALHLEAGVIFSRLSFLFEPVIYSGKSYFHSDRIEH 135 >AF491816-1|AAM09542.2| 225|Anopheles gambiae glutathione S-transferase E7 protein. Length = 225 Score = 24.2 bits (50), Expect = 2.6 Identities = 15/38 (39%), Positives = 18/38 (47%) Frame = +1 Query: 7 VHTDAHLPAGQIW*RRSQVITEAIRTAKDRKSWGGIEH 120 VHT HL AG I+ R S + I + K IEH Sbjct: 98 VHTALHLEAGVIFSRLSFLFEPVIYSGKSYFHSDRIEH 135 >EF519528-1|ABP73591.1| 250|Anopheles gambiae APL2 protein. Length = 250 Score = 23.4 bits (48), Expect = 4.5 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +3 Query: 216 KVVSLMALRGSLYHQLPFASVFGFSQ 293 K + + LRG+ H LP + FG S+ Sbjct: 17 KTLQSLYLRGNKIHDLPDVAFFGASR 42 >EF519526-1|ABP73589.1| 250|Anopheles gambiae APL2 protein. Length = 250 Score = 23.4 bits (48), Expect = 4.5 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +3 Query: 216 KVVSLMALRGSLYHQLPFASVFGFSQ 293 K + + LRG+ H LP + FG S+ Sbjct: 17 KTLQSLYLRGNKIHDLPDVAFFGASR 42 >EF519525-1|ABP73588.1| 250|Anopheles gambiae APL2 protein. Length = 250 Score = 23.4 bits (48), Expect = 4.5 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +3 Query: 216 KVVSLMALRGSLYHQLPFASVFGFSQ 293 K + + LRG+ H LP + FG S+ Sbjct: 17 KTLQSLYLRGNKIHDLPDVAFFGASR 42 >EF519524-1|ABP73587.1| 250|Anopheles gambiae APL2 protein. Length = 250 Score = 23.4 bits (48), Expect = 4.5 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +3 Query: 216 KVVSLMALRGSLYHQLPFASVFGFSQ 293 K + + LRG+ H LP + FG S+ Sbjct: 17 KTLQSLYLRGNKIHDLPDVAFFGASR 42 >EF519523-1|ABP73586.1| 250|Anopheles gambiae APL2 protein. Length = 250 Score = 23.4 bits (48), Expect = 4.5 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +3 Query: 216 KVVSLMALRGSLYHQLPFASVFGFSQ 293 K + + LRG+ H LP + FG S+ Sbjct: 17 KTLQSLYLRGNKIHDLPDVAFFGASR 42 >EF519522-1|ABP73585.1| 250|Anopheles gambiae APL2 protein. Length = 250 Score = 23.4 bits (48), Expect = 4.5 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +3 Query: 216 KVVSLMALRGSLYHQLPFASVFGFSQ 293 K + + LRG+ H LP + FG S+ Sbjct: 17 KTLQSLYLRGNKIHDLPDVAFFGASR 42 >EF519521-1|ABP73584.1| 250|Anopheles gambiae APL2 protein. Length = 250 Score = 23.4 bits (48), Expect = 4.5 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +3 Query: 216 KVVSLMALRGSLYHQLPFASVFGFSQ 293 K + + LRG+ H LP + FG S+ Sbjct: 17 KTLQSLYLRGNKIHDLPDVAFFGASR 42 >EF519520-1|ABP73583.1| 250|Anopheles gambiae APL2 protein. Length = 250 Score = 23.4 bits (48), Expect = 4.5 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +3 Query: 216 KVVSLMALRGSLYHQLPFASVFGFSQ 293 K + + LRG+ H LP + FG S+ Sbjct: 17 KTLQSLYLRGNKIHDLPDVAFFGASR 42 >EF519519-1|ABP73582.1| 250|Anopheles gambiae APL2 protein. Length = 250 Score = 23.4 bits (48), Expect = 4.5 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +3 Query: 216 KVVSLMALRGSLYHQLPFASVFGFSQ 293 K + + LRG+ H LP + FG S+ Sbjct: 17 KTLQSLYLRGNKIHDLPDVAFFGASR 42 >EF519517-1|ABP73580.1| 250|Anopheles gambiae APL2 protein. Length = 250 Score = 23.4 bits (48), Expect = 4.5 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +3 Query: 216 KVVSLMALRGSLYHQLPFASVFGFSQ 293 K + + LRG+ H LP + FG S+ Sbjct: 17 KTLQSLYLRGNKIHDLPDVAFFGASR 42 >EF519516-1|ABP73579.1| 250|Anopheles gambiae APL2 protein. Length = 250 Score = 23.4 bits (48), Expect = 4.5 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +3 Query: 216 KVVSLMALRGSLYHQLPFASVFGFSQ 293 K + + LRG+ H LP + FG S+ Sbjct: 17 KTLQSLYLRGNKIHDLPDVAFFGASR 42 >EF519515-1|ABP73578.1| 250|Anopheles gambiae APL2 protein. Length = 250 Score = 23.4 bits (48), Expect = 4.5 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +3 Query: 216 KVVSLMALRGSLYHQLPFASVFGFSQ 293 K + + LRG+ H LP + FG S+ Sbjct: 17 KTLQSLYLRGNKIHDLPDVAFFGASR 42 >EF519514-1|ABP73577.1| 250|Anopheles gambiae APL2 protein. Length = 250 Score = 23.4 bits (48), Expect = 4.5 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +3 Query: 216 KVVSLMALRGSLYHQLPFASVFGFSQ 293 K + + LRG+ H LP + FG S+ Sbjct: 17 KTLQSLYLRGNKIHDLPDVAFFGASR 42 >EF519513-1|ABP73576.1| 250|Anopheles gambiae APL2 protein. Length = 250 Score = 23.4 bits (48), Expect = 4.5 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +3 Query: 216 KVVSLMALRGSLYHQLPFASVFGFSQ 293 K + + LRG+ H LP + FG S+ Sbjct: 17 KTLQSLYLRGNKIHDLPDVAFFGASR 42 >EF519512-1|ABP73575.1| 250|Anopheles gambiae APL2 protein. Length = 250 Score = 23.4 bits (48), Expect = 4.5 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +3 Query: 216 KVVSLMALRGSLYHQLPFASVFGFSQ 293 K + + LRG+ H LP + FG S+ Sbjct: 17 KTLQSLYLRGNKIHDLPDVAFFGASR 42 >EF519511-1|ABP73574.1| 250|Anopheles gambiae APL2 protein. Length = 250 Score = 23.4 bits (48), Expect = 4.5 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +3 Query: 216 KVVSLMALRGSLYHQLPFASVFGFSQ 293 K + + LRG+ H LP + FG S+ Sbjct: 17 KTLQSLYLRGNKIHDLPDVAFFGASR 42 >EF519510-1|ABP73573.1| 250|Anopheles gambiae APL2 protein. Length = 250 Score = 23.4 bits (48), Expect = 4.5 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +3 Query: 216 KVVSLMALRGSLYHQLPFASVFGFSQ 293 K + + LRG+ H LP + FG S+ Sbjct: 17 KTLQSLYLRGNKIHDLPDVAFFGASR 42 >EF519509-1|ABP73572.1| 250|Anopheles gambiae APL2 protein. Length = 250 Score = 23.4 bits (48), Expect = 4.5 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +3 Query: 216 KVVSLMALRGSLYHQLPFASVFGFSQ 293 K + + LRG+ H LP + FG S+ Sbjct: 17 KTLQSLYLRGNKIHDLPDVAFFGASR 42 >EF519508-1|ABP73571.1| 250|Anopheles gambiae APL2 protein. Length = 250 Score = 23.4 bits (48), Expect = 4.5 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +3 Query: 216 KVVSLMALRGSLYHQLPFASVFGFSQ 293 K + + LRG+ H LP + FG S+ Sbjct: 17 KTLQSLYLRGNKIHDLPDVAFFGASR 42 >EF519507-1|ABP73570.1| 250|Anopheles gambiae APL2 protein. Length = 250 Score = 23.4 bits (48), Expect = 4.5 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +3 Query: 216 KVVSLMALRGSLYHQLPFASVFGFSQ 293 K + + LRG+ H LP + FG S+ Sbjct: 17 KTLQSLYLRGNKIHDLPDVAFFGASR 42 >AY118017-1|AAM66816.1| 120|Anopheles gambiae glucose-6-phosphate dehydrogenase protein. Length = 120 Score = 23.4 bits (48), Expect = 4.5 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = +1 Query: 373 FYLALPQSIFQGCLV 417 FYLALP S+F+ V Sbjct: 73 FYLALPPSVFESVTV 87 >AY118012-1|AAM66811.1| 120|Anopheles gambiae glucose-6-phosphate dehydrogenase protein. Length = 120 Score = 23.4 bits (48), Expect = 4.5 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = +1 Query: 373 FYLALPQSIFQGCLV 417 FYLALP S+F+ V Sbjct: 73 FYLALPPSVFESVTV 87 >AY118011-1|AAM66810.1| 120|Anopheles gambiae glucose-6-phosphate dehydrogenase protein. Length = 120 Score = 23.4 bits (48), Expect = 4.5 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = +1 Query: 373 FYLALPQSIFQGCLV 417 FYLALP S+F+ V Sbjct: 73 FYLALPPSVFESVTV 87 >AY118010-1|AAM66809.1| 120|Anopheles gambiae glucose-6-phosphate dehydrogenase protein. Length = 120 Score = 23.4 bits (48), Expect = 4.5 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = +1 Query: 373 FYLALPQSIFQGCLV 417 FYLALP S+F+ V Sbjct: 73 FYLALPPSVFESVTV 87 >AY118002-1|AAM66801.1| 120|Anopheles gambiae glucose-6-phosphate dehydrogenase protein. Length = 120 Score = 23.4 bits (48), Expect = 4.5 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = +1 Query: 373 FYLALPQSIFQGCLV 417 FYLALP S+F+ V Sbjct: 73 FYLALPPSVFESVTV 87 >AY118001-1|AAM66800.1| 120|Anopheles gambiae glucose-6-phosphate dehydrogenase protein. Length = 120 Score = 23.4 bits (48), Expect = 4.5 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = +1 Query: 373 FYLALPQSIFQGCLV 417 FYLALP S+F+ V Sbjct: 73 FYLALPPSVFESVTV 87 >AY118000-1|AAM66799.1| 120|Anopheles gambiae glucose-6-phosphate dehydrogenase protein. Length = 120 Score = 23.4 bits (48), Expect = 4.5 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = +1 Query: 373 FYLALPQSIFQGCLV 417 FYLALP S+F+ V Sbjct: 73 FYLALPPSVFESVTV 87 >AY117999-1|AAM66798.1| 120|Anopheles gambiae glucose-6-phosphate dehydrogenase protein. Length = 120 Score = 23.4 bits (48), Expect = 4.5 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = +1 Query: 373 FYLALPQSIFQGCLV 417 FYLALP S+F+ V Sbjct: 73 FYLALPPSVFESVTV 87 >AY117998-1|AAM66797.1| 120|Anopheles gambiae glucose-6-phosphate dehydrogenase protein. Length = 120 Score = 23.4 bits (48), Expect = 4.5 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = +1 Query: 373 FYLALPQSIFQGCLV 417 FYLALP S+F+ V Sbjct: 73 FYLALPPSVFESVTV 87 >AY117997-1|AAM66796.1| 120|Anopheles gambiae glucose-6-phosphate dehydrogenase protein. Length = 120 Score = 23.4 bits (48), Expect = 4.5 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = +1 Query: 373 FYLALPQSIFQGCLV 417 FYLALP S+F+ V Sbjct: 73 FYLALPPSVFESVTV 87 >AY117996-1|AAM66795.1| 120|Anopheles gambiae glucose-6-phosphate dehydrogenase protein. Length = 120 Score = 23.4 bits (48), Expect = 4.5 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = +1 Query: 373 FYLALPQSIFQGCLV 417 FYLALP S+F+ V Sbjct: 73 FYLALPPSVFESVTV 87 >AY117995-1|AAM66794.1| 120|Anopheles gambiae glucose-6-phosphate dehydrogenase protein. Length = 120 Score = 23.4 bits (48), Expect = 4.5 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = +1 Query: 373 FYLALPQSIFQGCLV 417 FYLALP S+F+ V Sbjct: 73 FYLALPPSVFESVTV 87 >AY117994-1|AAM66793.1| 120|Anopheles gambiae glucose-6-phosphate dehydrogenase protein. Length = 120 Score = 23.4 bits (48), Expect = 4.5 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = +1 Query: 373 FYLALPQSIFQGCLV 417 FYLALP S+F+ V Sbjct: 73 FYLALPPSVFESVTV 87 >AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein protein. Length = 3325 Score = 23.4 bits (48), Expect = 4.5 Identities = 10/37 (27%), Positives = 20/37 (54%) Frame = +3 Query: 60 GNNRGYKNRQGQKVMGWHRASSDQHFKLDTTFERDRL 170 G R +++QG+KV + + + D+ +RDR+ Sbjct: 1571 GTTRRERSKQGRKVSDQSSSQTSPSKRKDSVTKRDRI 1607 >AF317817-1|AAL18436.1| 137|Anopheles gambiae glucose-6-phosphate dehydrogenase protein. Length = 137 Score = 23.4 bits (48), Expect = 4.5 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = +1 Query: 373 FYLALPQSIFQGCLV 417 FYLALP S+F+ V Sbjct: 81 FYLALPPSVFESVTV 95 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 535,932 Number of Sequences: 2352 Number of extensions: 10513 Number of successful extensions: 47 Number of sequences better than 10.0: 37 Number of HSP's better than 10.0 without gapping: 45 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 47 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 45668772 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -