BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0587 (676 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC688.08 |srb8|med12|mediator complex subunit Srb8 |Schizosacc... 25 7.6 SPCC126.14 |prp18||U5 snRNP-associated protein Prp18|Schizosacch... 25 7.6 SPCC970.06 |||cargo receptor for soluble proteins |Schizosacchar... 25 10.0 >SPAC688.08 |srb8|med12|mediator complex subunit Srb8 |Schizosaccharomyces pombe|chr 1|||Manual Length = 1233 Score = 25.4 bits (53), Expect = 7.6 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = -2 Query: 642 ILRLSWNWRIRCWWIIGPGHYKSSWHRSSRYVYR 541 ILR+S + + ++I+ G+Y W YV R Sbjct: 529 ILRMSQQLKNKIYYILSKGNYFVDWSICDEYVKR 562 >SPCC126.14 |prp18||U5 snRNP-associated protein Prp18|Schizosaccharomyces pombe|chr 3|||Manual Length = 343 Score = 25.4 bits (53), Expect = 7.6 Identities = 12/32 (37%), Positives = 22/32 (68%), Gaps = 1/32 (3%) Frame = -2 Query: 384 LQH*IHSWDTFL-NKNVSFEKVSKLPIELEMF 292 LQH I WD FL +K+++ + S+ ++L++F Sbjct: 198 LQHGIRIWDNFLSSKSINSFESSESQMQLKIF 229 >SPCC970.06 |||cargo receptor for soluble proteins |Schizosaccharomyces pombe|chr 3|||Manual Length = 302 Score = 25.0 bits (52), Expect = 10.0 Identities = 11/41 (26%), Positives = 18/41 (43%) Frame = +2 Query: 539 ILYTYLEDLCQLDL*WPGPIIHQHRILQFQLNLKMTLLITC 661 I+ TY ED ++ WP + + +F+ LL C Sbjct: 62 IVATYFEDAIRIVTQWPEQVSYMRDYRRFRFGTAPLLLFVC 102 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,499,199 Number of Sequences: 5004 Number of extensions: 46056 Number of successful extensions: 100 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 97 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 100 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 309878492 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -